Align The SnatA carrier. Transports glycine, L-alanine, L-serine, L-threonine and a variety of neutral L-amino acids (characterized)
to candidate AO356_08255 AO356_08255 hypothetical protein
Query= TCDB::Q8J305 (216 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_08255 Length = 198 Score = 110 bits (275), Expect = 2e-29 Identities = 68/205 (33%), Positives = 111/205 (54%), Gaps = 12/205 (5%) Query: 8 LKYLILLYGGLFAITNPVGAVPVFLSVTHDLSWRERREIASKTAISVVATLVVFALLGQW 67 L L +Y + + +P + F+ +T S +E+R +A K A + + + V+ L G+ Sbjct: 2 LHVLFSVYLKMLVLYSPFFVLSCFIGLTRGYSRKEQRRLAWKVATATLISSVLLYLFGRV 61 Query: 68 IFKFFGSSTDAFAIAGGILLFRMALDMLSGKLSSVKISNEETEEFSEEVVTLEEVAIIPL 127 IF FG + DAF I G +LF AL M GK S+V+ N + ++V I+PL Sbjct: 62 IFSVFGITVDAFRIGAGSVLFISALGMAQGK-SAVQTDNVQ-----------QDVTIVPL 109 Query: 128 AIPLISGPGAITTVMLYMAKSTTNLQRLAVILTIILIGITVWFVLCSANRIKARLGRVGI 187 IPL GPG I +++ +L I++I L TV VL ++RI+ LG G+ Sbjct: 110 TIPLTVGPGTIGALLVMGVSQPHWDDKLMAIISIALASFTVGVVLYLSSRIERILGDQGL 169 Query: 188 KVMTRMMGLILTSMAVQMIINGIKG 212 ++++R+MGL + ++A Q+I G+KG Sbjct: 170 QIVSRLMGLFVCALAAQIIFTGVKG 194 Lambda K H 0.327 0.141 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 110 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 198 Length adjustment: 21 Effective length of query: 195 Effective length of database: 177 Effective search space: 34515 Effective search space used: 34515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory