GapMind for catabolism of small carbon sources

 

Aligments for a candidate for tdcB in Pseudomonas fluorescens FW300-N2C3

Align L-threonine dehydratase biosynthetic IlvA; EC 4.3.1.19; Threonine deaminase (uncharacterized)
to candidate AO356_27710 AO356_27710 threonine dehydratase

Query= curated2:P37946
         (422 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27710 AO356_27710
           threonine dehydratase
          Length = 333

 Score =  230 bits (586), Expect = 5e-65
 Identities = 133/331 (40%), Positives = 193/331 (58%), Gaps = 9/331 (2%)

Query: 7   ENSLIQ--VKHILKAHQNVKDVVIHTPLQRNDRLSERYECNIYLKREDLQVVRSFKLRGA 64
           E +L++  VK IL A   V ++ + TPLQ    LSE     I LKREDLQ   SFK+RGA
Sbjct: 7   EQTLLEHYVKKILAAP--VYELAVRTPLQAAPALSEALGNRILLKREDLQPTFSFKIRGA 64

Query: 65  YHKMKQLSSEQTENGVVCASAGNHAQGVAFSCKHLGIHGKIFMPSTTPRQKVSQVELFGK 124
           Y+K+  L+ EQ   GV+ ASAGNHAQGVA + + LGI  +I MP TTP+ KV  V   G 
Sbjct: 65  YNKLVHLTPEQRARGVITASAGNHAQGVALAARELGISARIVMPVTTPQLKVLGVRNRGA 124

Query: 125 GFIDIILTGDTFDDVYKSAAECCEAESRTFIHPFDDPDVMAGQGTLAVEILNDIDTEPHF 184
              + +L GD+F      A E  E   R F+ PFDDPDV+AGQGT+A+EIL         
Sbjct: 125 ---EALLHGDSFPFALAHALELAEQTGREFVSPFDDPDVIAGQGTVAMEILRQHPGRLDA 181

Query: 185 LFASVGGGGLLSGVGTYLKNVSPDTKVIAVEPAGAASYFESNKAGHVVTLDKIDKFVDGA 244
           +F  VGGGGL++G+  Y+K + P+ ++I VE   +A    +  AG  VTL ++  F DG 
Sbjct: 182 IFVPVGGGGLIAGIAAYVKYLRPEVRIIGVESQHSACLQAALAAGERVTLPEVGTFADGV 241

Query: 245 AVKKIGEETFRTLETVVDDILLVPEGKVCTSILELYNECAVVAEPAGALSVAALDLY--K 302
           AV +IG          VD+++ V   ++C +I ++Y++   + EP+GAL+VA +  Y   
Sbjct: 242 AVAQIGAHGLDICRFCVDEVMTVSNDQLCAAIKDIYDDTRSITEPSGALAVAGIKQYVAH 301

Query: 303 DQIKGKNVVCVVSGGNNDIGRMQEMKERSLI 333
              +G+ +V + SG N +   ++ + ER+ +
Sbjct: 302 TGARGETLVAIDSGANINFDSLRHVAERAAV 332


Lambda     K      H
   0.318    0.137    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 329
Number of extensions: 15
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 422
Length of database: 333
Length adjustment: 30
Effective length of query: 392
Effective length of database: 303
Effective search space:   118776
Effective search space used:   118776
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate AO356_27710 AO356_27710 (threonine dehydratase)
to HMM TIGR01124 (ilvA: threonine ammonia-lyase, biosynthetic (EC 4.3.1.19))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01124.hmm
# target sequence database:        /tmp/gapView.18024.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01124  [M=499]
Accession:   TIGR01124
Description: ilvA_2Cterm: threonine ammonia-lyase, biosynthetic
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
   5.4e-152  492.8   1.0   6.2e-152  492.6   1.0    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27710  AO356_27710 threonine dehydratas


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27710  AO356_27710 threonine dehydratase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  492.6   1.0  6.2e-152  6.2e-152       2     321 ..      14     333 .]      13     333 .] 1.00

  Alignments for each domain:
  == domain 1  score: 492.6 bits;  conditional E-value: 6.2e-152
                                       TIGR01124   2 ylrailkarvyeaavetplekaaklserlknrvllkredlqpvfsfklrGaynkmaqlsaeqk 64 
                                                     y+++il a vye av tpl+ a  lse l+nr+llkredlqp fsfk+rGaynk+ +l++eq+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27710  14 YVKKILAAPVYELAVRTPLQAAPALSEALGNRILLKREDLQPTFSFKIRGAYNKLVHLTPEQR 76 
                                                     899************************************************************ PP

                                       TIGR01124  65 akGviaasaGnhaqGvalsakklGvkavivmpettpeikvdavkafGgevvlhGenydeakak 127
                                                     a+Gvi+asaGnhaqGval+a++lG++a ivmp ttp++kv  v+++G+e +lhG+++  a a+
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27710  77 ARGVITASAGNHAQGVALAARELGISARIVMPVTTPQLKVLGVRNRGAEALLHGDSFPFALAH 139
                                                     *************************************************************** PP

                                       TIGR01124 128 alelaqekgltfiapfddplviaGqGtvalellrqveedldavfvpvGGGGliaGvaalvkql 190
                                                     alela++ g  f++pfddp+viaGqGtva+e+lrq+   lda+fvpvGGGGliaG+aa+vk l
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27710 140 ALELAEQTGREFVSPFDDPDVIAGQGTVAMEILRQHPGRLDAIFVPVGGGGLIAGIAAYVKYL 202
                                                     *************************************************************** PP

                                       TIGR01124 191 lpeikvigveaedsaalkqaleaGervkldqvGlfadGvavkevGdetfrlckeylddivlvd 253
                                                     +pe+++igve++ sa+l++al+aGerv+l +vG fadGvav ++G++ +++c+  +d++++v 
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27710 203 RPEVRIIGVESQHSACLQAALAAGERVTLPEVGTFADGVAVAQIGAHGLDICRFCVDEVMTVS 265
                                                     *************************************************************** PP

                                       TIGR01124 254 tdevcaaikdvfedtravlepaGalalaGlkkyvakkgiedktlvailsGanlnfdrlryvse 316
                                                      d++caaikd+++dtr+++ep+Gala+aG+k+yva+ g++++tlvai sGan+nfd+lr+v+e
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27710 266 NDQLCAAIKDIYDDTRSITEPSGALAVAGIKQYVAHTGARGETLVAIDSGANINFDSLRHVAE 328
                                                     *************************************************************** PP

                                       TIGR01124 317 raelG 321
                                                     ra +G
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_27710 329 RAAVG 333
                                                     **998 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (499 nodes)
Target sequences:                          1  (333 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 8.72
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory