GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acs in Pseudomonas fluorescens FW300-N2C3

Align Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; EC 6.2.1.1; Acetate--CoA ligase; Acyl-activating enzyme (uncharacterized)
to candidate AO356_26340 AO356_26340 AMP-binding protein

Query= curated2:C1AA44
         (654 letters)



>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_26340 AO356_26340
           AMP-binding protein
          Length = 554

 Score =  281 bits (719), Expect = 6e-80
 Identities = 190/556 (34%), Positives = 278/556 (50%), Gaps = 52/556 (9%)

Query: 75  LNASVNCIDRHVHGPRRNKAALIWEGEPGDRRTFTYWDLYREVNLAANMLKKLGVGRGDR 134
           LNA V C DRH    R    AL WEG  G   T+TY DL       AN L+  GVG+GD+
Sbjct: 28  LNACVECCDRHALPGR---IALFWEGRDGSEATWTYRDLQDNAARFANFLRAQGVGKGDK 84

Query: 135 VAIYLPMIPEAVIAMLACARIGAIHTVVFGGFAPESLRDRINDCGCKLLITADGGSRRGQ 194
           VA  LP   E +I +LA  RIGA++  +F  F P+++  R+   G ++++T         
Sbjct: 85  VAGLLPRTAELLIVVLATWRIGAVYQPLFTAFGPKAIEHRLGSSGARIVVT--------D 136

Query: 195 MVPLKRNADVALKECPSIENVLVVMRRRSGVGDETFAEMQEGRDHWWHRLKRQVPRYCEP 254
            V   +  +VA   CP+I  V          G E    +  G   +W  +  Q  + CEP
Sbjct: 137 AVNRPKLNEVA--GCPTIVTV----------GGEKGQGIVRGDYSFWAEVANQSSQ-CEP 183

Query: 255 EAMDAEDVLFVLYTSGTTGKPKGIVHTTGGFLTGVATTTKYTFDLKEEDVYWCTADIGWI 314
             +  ED   +++TSGTTG  K +       +    + T+   DL+ ED +W  AD GW 
Sbjct: 184 LMLTGEDPFLLMFTSGTTGPAKALSVPLKA-IVAFQSYTRDAVDLRPEDAFWNVADPGWA 242

Query: 315 TGHSYLVYGPLANGATCVMYEGAPDWPDKDRFWQICERYGVTILYTAPTAIRAFMKWGTE 374
            G  + V GPLA G     Y+G        R   +  +YG+T L  +PTA R  +  G +
Sbjct: 243 YGIYFGVTGPLAMGHPITFYDGPFTLESTCR---VINKYGITNLTGSPTAYRLLIAGGEQ 299

Query: 375 YVKKHDLSQLRVLGSVGEPINPEAWMWYHEHIGDFQCPIVDTWWQTETGAIMITPLPGVT 434
           + +     +LR++ S GEP+NPE   W+ +++      I D + QTE G ++        
Sbjct: 300 FARSIK-GKLRIVSSAGEPLNPEVIRWFADNLN---VVIHDHYGQTELGMVLCNHHGLEH 355

Query: 435 TTKPGSATVPFPGIRTALLDANANELTVGG-GLLAITHPWPSMLRTIWGDDQRYVDTYFS 493
               G+A    PG R  +LD    EL VG  G+LA+      M              +F+
Sbjct: 356 PVHLGAAGFASPGHRIVVLDEEQRELGVGQPGILAVDRSQSPMC-------------WFA 402

Query: 494 KWPGRP------DLYFPGDGAKLDEDGYLWILGRVDDVLNVSGHRIGTMEVESALVDHPS 547
            + G P      D Y  GD  +L+ DG +  +GR DDV+  SG+R+G  +VESAL++HP+
Sbjct: 403 GYEGAPTKAFVGDYYLSGDTVELNPDGSISFVGRSDDVITTSGYRVGPFDVESALIEHPA 462

Query: 548 VAEAAVVGKHHDLKGQAIAAFVTLRAGFTASGSLRDELRDHVAQKIGALARPDDILFSAD 607
           V E AV+GK    + + + AFV L + + AS  L +ELR HV +++ A A P +I F +D
Sbjct: 463 VVETAVIGKPDPERTELVKAFVVLSSQYRASPELAEELRLHVRKRLAAHAYPREIEFVSD 522

Query: 608 LPKTRSGKIMRRLLRD 623
           LPKT SGK+ R +LR+
Sbjct: 523 LPKTPSGKLQRFILRN 538


Lambda     K      H
   0.320    0.137    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 898
Number of extensions: 47
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 654
Length of database: 554
Length adjustment: 37
Effective length of query: 617
Effective length of database: 517
Effective search space:   318989
Effective search space used:   318989
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory