Align Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized)
to candidate AO356_28580 AO356_28580 sugar ABC transporter permease
Query= TCDB::Q72KX4 (268 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28580 Length = 280 Score = 138 bits (347), Expect = 1e-37 Identities = 85/273 (31%), Positives = 143/273 (52%), Gaps = 10/273 (3%) Query: 1 MGRALLYGFLLLMAGFFLLPVYLVVLTALKEPARITLETVWQWPHPPYWESFRTAWE--A 58 +G L LL+ A F P Y ++T+LK + L V W P + ++ + Sbjct: 13 LGFWCLIAILLVYAVF---PFYYAIVTSLKPSS--ALFQVSYWIDQPDFSNYAAVLNQAS 67 Query: 59 FRPKFQNSVVLAVSATLLSALVGSLNGYVLAKWPFRGSGLLFALILFGMFIPYQSILIPL 118 F NS+V+A+ L+ + Y L + FRG G + ++L P ++L L Sbjct: 68 FLRAIGNSLVVALCVVALALFLSLTAAYALGRVKFRGRGPVLMMVLGVSMFPQVAVLSGL 127 Query: 119 FQFMKSIGLYGSLFGLVLVHVIYGIPIVTLIFRNYYSEIPDELVEAARIDGAGFFGIFRH 178 F+ ++++GLY + + L+L + I+ +P + + ++P EL EAA +DGA + Sbjct: 128 FEVIRALGLYNTSWALILSYTIFTLPFTVWVLTTFMGQLPHELEEAAIMDGASPWVTLTR 187 Query: 179 VILPLSVPAFVVVAIWQFTQIWNEFLFAVTLTRPESQ-PITVALAQLAGG--EAVKWNLP 235 V+LPL PA V + F WNEFLFA+T T +SQ + VA+A ++GG + W L Sbjct: 188 VLLPLLWPALVTTGLLAFIAAWNEFLFALTFTLTDSQRTVPVAIALISGGSPHELPWGLL 247 Query: 236 MAGAILAALPTLLVYILLGRYFLRGLLAGSVKG 268 MA ++L +P +++ ++ R + GL AG++KG Sbjct: 248 MAASVLVTVPLVILVLIFQRRIVSGLTAGALKG 280 Lambda K H 0.330 0.146 0.461 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 280 Length adjustment: 25 Effective length of query: 243 Effective length of database: 255 Effective search space: 61965 Effective search space used: 61965 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory