Align predicted cytochrome c component of periplasmic glucoside 3-dehydrogenase (EC 1.1.99.13) (characterized)
to candidate AO356_25070 AO356_25070 cytochrome C biogenesis protein CcsA
Query= reanno::Cola:Echvi_1841 (141 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_25070 Length = 102 Score = 71.2 bits (173), Expect = 4e-18 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 1/82 (1%) Query: 59 EGLALVKESDCPSCHMVERKIVGPAYKDVAEKYESTDENIETLAKRVVDGNNGVWGQVPM 118 +G L K C +CH ++ K+VGPA K+VA K + LAK + +G G WG +PM Sbjct: 22 DGPTLFKSKPCAACHSIDTKVVGPALKEVAAKNAGVAGAQDLLAKHIKEGTQGNWGPMPM 81 Query: 119 PAHPGLSEDDAKKMVKYILMLK 140 PA+P ++E++AK + ++L LK Sbjct: 82 PANP-VTEEEAKILAAWVLTLK 102 Lambda K H 0.309 0.127 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 38 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 141 Length of database: 102 Length adjustment: 13 Effective length of query: 128 Effective length of database: 89 Effective search space: 11392 Effective search space used: 11392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.3 bits) S2: 41 (20.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory