Align tryptophan permease (characterized)
to candidate AO356_11625 AO356_11625 GABA permease
Query= CharProtDB::CH_091156 (592 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_11625 Length = 464 Score = 202 bits (514), Expect = 2e-56 Identities = 126/402 (31%), Positives = 210/402 (52%), Gaps = 9/402 (2%) Query: 69 LDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQII 128 + G+ + NL + LKPRH+ M++I G IG GLFVGSG AIA GP V++ +A AG+ ++ Sbjct: 1 MSGTQTSDNLAQGLKPRHVTMLSIAGVIGAGLFVGSGHAIAAAGP-AVLLAYAAAGALVV 59 Query: 129 GTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQY 188 + LGE+ V P G+F+ Y R + F + +Y W V+PLE AAA + Sbjct: 60 LVMRMLGEMAVASPDTGSFSTYADRAIGHWAGFTIGWLYWWFWVLVIPLEANAAATILHA 119 Query: 189 WNSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGP 248 W ++ ++ + ++ NLF V+ +GE EF F+ +K + + GFI L ++ I G P Sbjct: 120 WFPNVAIWVFTLVITLLLTVTNLFSVKNYGEFEFWFALVKVVAIIGFIGLGLMAIFGVLP 179 Query: 249 DHEFIGAKYWHD-PGCLANGFPGVLSVLVVASYSLGGIEMTCLASGETDPKG--LPSAIK 305 + G + D G L NG VL ++ +S G E+ +A+ E+ G + A Sbjct: 180 TSQVSGVSHLFDTQGFLPNGMGAVLGAILTTMFSFMGTEIVTIAAAESKNPGQQISKATN 239 Query: 306 QVFWRILFFFLISLTLVGFLVPYTNQNLLGGSSVDNSPFVIAIKLHHIKALPSIVNAVIL 365 V WRI F+L+S+ +V LVP+ + L S + ++ I IV+ V+L Sbjct: 240 SVIWRIGLFYLVSIFIVVALVPWNDPLLASVGS-----YQTVLERMGIPNAKLIVDIVVL 294 Query: 366 ISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSG 425 ++V S NS ++ +SR + S+ +G P +++G P +M ++ LA Sbjct: 295 VAVTSCLNSALYTASRMMFSLGKRGDAPAVSQRTNKSGTPHWAVMLSTGAAFLAVFANYV 354 Query: 426 SMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSL 467 + + VF +L+A +G +V+L I +S +R R A+G+ + Sbjct: 355 APAAVFEFLLASSGAIALLVYLVIAVSQLRMRKQRMARGEKI 396 Lambda K H 0.326 0.141 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 691 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 592 Length of database: 464 Length adjustment: 35 Effective length of query: 557 Effective length of database: 429 Effective search space: 238953 Effective search space used: 238953 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory