Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate AO356_05515 AO356_05515 amino acid transporter
Query= uniprot:P70970 (276 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_05515 Length = 254 Score = 135 bits (339), Expect = 1e-36 Identities = 80/225 (35%), Positives = 131/225 (58%), Gaps = 13/225 (5%) Query: 6 ERLALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNK 65 E L ++ K G +++IG +GSGKST L+ +N L +P G ++L +Q K Sbjct: 15 EHEVLKGVSLKAKTGDVISLIGASGSGKSTFLRCINFLEQPNDGAMTLDGQPVQMIKDRH 74 Query: 66 --------DLKKLRKKVGIVFQFPEHQLFEE-TVLKDISFGPMN-FGVKKEDAEQKAREM 115 +L+++R ++ +VFQ L+ TVL++I+ P GV K++A+ +AR Sbjct: 75 GMHVADADELQRIRTRLAMVFQ--HFNLWSHMTVLENITMAPRRVLGVSKQEADDRARRY 132 Query: 116 LQLVGLSEELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMF 175 L VGL + ++ P LSGGQ +RVAIA LAM+PEV++ DEPT+ LDP E++ + Sbjct: 133 LDKVGLPARVAEQYPAFLSGGQQQRVAIARALAMEPEVMLFDEPTSALDPELVGEVLKVI 192 Query: 176 YELHQRGNLTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDL 220 L + G T I+VTH M A +++++ +H+G ++ G+P D+ Sbjct: 193 QGLAEEGR-TMIMVTHEMSFARKVSNQVLFLHQGLVEEEGAPEDV 236 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 254 Length adjustment: 25 Effective length of query: 251 Effective length of database: 229 Effective search space: 57479 Effective search space used: 57479 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory