Align Metapyrocatechase 2; MPC; EC 1.13.11.2; CatO2ase; Catechol 2,3-dioxygenase II (uncharacterized)
to candidate AO356_29165 AO356_29165 glyoxalase
Query= curated2:P17296 (320 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_29165 Length = 312 Score = 80.5 bits (197), Expect = 5e-20 Identities = 53/161 (32%), Positives = 74/161 (45%), Gaps = 9/161 (5%) Query: 140 SPARLEGAPGGQRGAVVR----SQVQRVLPRRLSHVLLFTPSVQRALDFYRDALGLRLSD 195 +PA L APG V + + LPR LSHV+ F P +A FY+ LG +D Sbjct: 124 APADLTNAPGHAPQRPVNQPGINPDMQALPRTLSHVVYFVPDAAKAEAFYK-RLGFVTTD 182 Query: 196 RSDDVIAFTHAPYGSDHHLLALVKSSA--RGWHHAAWDVADVNEVGQGASQMAKAGYTQG 253 F DHH L ++++ +G H + + EV + + G+T Sbjct: 183 TFVGAGPFMRPAGSDDHHCLFMIQTPPHMKGCEHFTFHMGSGTEVLLAGRRFEQQGWTSF 242 Query: 254 WGTGRHVLGSNYFFYVLDPWGSFCEYSADIDYIPAGQAWPA 294 WG GRH+ GSN+F+Y P G EY AD+D AW A Sbjct: 243 WGPGRHLFGSNWFWYFNSPLGCHIEYDADMD--KHDDAWQA 281 Lambda K H 0.320 0.136 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 312 Length adjustment: 27 Effective length of query: 293 Effective length of database: 285 Effective search space: 83505 Effective search space used: 83505 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory