Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate AO356_28380 AO356_28380 ABC transporter permease
Query= uniprot:Q1MCU1 (463 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28380 Length = 355 Score = 132 bits (333), Expect = 1e-35 Identities = 107/329 (32%), Positives = 158/329 (48%), Gaps = 25/329 (7%) Query: 112 LIALLLYPMVVVAIKGPQGSLTYVDNFGIQILIYVMLAWGLNIVVGLAGLLDLGYVAFYA 171 L ALLL+ VVV G + I L+ + GLN++ G AG L LG AF A Sbjct: 29 LAALLLFAFVVVPWLGND---YWFSAILIPFLVLSLAGLGLNLLTGYAGQLSLGSAAFMA 85 Query: 172 VGAYS-YALLSSYFGLSFWVLLPLSGIFAALWGVILGFPVLRLRGDYLAIVTLAFGEIIR 230 VGA++ Y L GL V + L G+ AAL V+ G P LR++G YL + TLA + Sbjct: 86 VGAFATYNLEIRVAGLPLLVSIALGGLTAALVAVLFGLPSLRIKGFYLLVSTLAAQFFVT 145 Query: 231 LVLINWTDVTKGTF-GISSIPKATLFGIPFDATAGGFAKLFHLPISSAYYKIFLFYLILA 289 L ++ + + G+ S P+ +FG+ DA AG + L L+ Sbjct: 146 WALTRFSWFSNNSASGVISAPRLDVFGVNLDAPAGRYL------------------LTLS 187 Query: 290 LCMLTAYVTIRLRRMPIGRAWEALREDEIACRSLGINTVTTKLTAFATGAMFAGFAGSFF 349 + + ++ L R +GR W A+R+ + A +GI TKL AFA F G AG+ + Sbjct: 188 VVVALFWLGKNLVRSELGRNWMAVRDMDTAAAVIGIALAKTKLLAFAISGFFLGVAGALW 247 Query: 350 A-ARQGFVSPESFVFLESAVILAIVVLGGMGSLTGIAIAAIVMVGGTELLREM-SFLKLI 407 A A G V P F S IL I+++GG+GSL G + A +V LL + S L Sbjct: 248 AFAYLGTVEPHGFDLNRSFQILFIIIIGGLGSLLGNFLGAAFIVLFPVLLSNLVSLLPGG 307 Query: 408 FGPDFTPELYRMLIFGLAMVVVMLFKPRG 436 E + +IFG +++ ++ +P G Sbjct: 308 LVDAGQVENLQKMIFGALIILFLIKEPEG 336 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 355 Length adjustment: 31 Effective length of query: 432 Effective length of database: 324 Effective search space: 139968 Effective search space used: 139968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory