GapMind for catabolism of small carbon sources


Aligments for a candidate for mmsA in Pseudomonas fluorescens FW300-N2C3

Align malonate-semialdehyde dehydrogenase (EC; malonate-semialdehyde dehydrogenase (acetylating) (EC; methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC (characterized)
to candidate AO356_07950 AO356_07950 methylmalonate-semialdehyde dehydrogenase

Query= BRENDA::A0A081YAY7
         (498 letters)

>lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07950 AO356_07950
           methylmalonate-semialdehyde dehydrogenase
          Length = 497

 Score =  905 bits (2339), Expect = 0.0
 Identities = 444/496 (89%), Positives = 466/496 (93%)










Lambda     K      H
   0.319    0.137    0.411 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 908
Number of extensions: 17
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 498
Length of database: 497
Length adjustment: 34
Effective length of query: 464
Effective length of database: 463
Effective search space:   214832
Effective search space used:   214832
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

Align candidate AO356_07950 AO356_07950 (methylmalonate-semialdehyde dehydrogenase)
to HMM TIGR01722 (mmsA: methylmalonate-semialdehyde dehydrogenase (acylating) (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01722.hmm
# target sequence database:        /tmp/gapView.12209.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01722  [M=477]
Accession:   TIGR01722
Description: MMSDH: methylmalonate-semialdehyde dehydrogenase (acylating)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                       -----------
   7.7e-212  690.1   0.0   8.7e-212  689.9   0.0    1.0  1  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07950  AO356_07950 methylmalonate-semia

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07950  AO356_07950 methylmalonate-semialdehyde dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  689.9   0.0  8.7e-212  8.7e-212       3     477 .]       6     481 ..       4     481 .. 0.99

  Alignments for each domain:
  == domain 1  score: 689.9 bits;  conditional E-value: 8.7e-212
                                       TIGR01722   3 hlidGkfvegksdkyipvsnpatnevlakvaeasaeevdaavasaretfaawaetsvaerarv 65 
                                                     hli+G+ + + s++  +v np t++ + kv+ a  + +++a+ +a+ +f+aw++t+ a+ra+v
                                                     78888876.678999************************************************ PP

                                       TIGR01722  66 llryqallkehrdeiaklisaeqGktledakGdvarGlevvehacsvtslllGetvesvakdv 128
                                                     ++r+++ll++++  ia+lis e+Gktleda G++ rG+e ve+ac+ + +l+Ge + +v  ++
                                                     *************************************************************** PP

                                       TIGR01722 129 dvysirqplGvvaGitpfnfpamiplwmfplaiacGntfvlkpsekvpsaavklaellseaGa 191
                                                     d +s  qplGvvaGitpfnfpam+plwm+plai+cGn+f+lkpse++ps+++ +a+ll+eaG+
                                                     *************************************************************** PP

                                       TIGR01722 192 pdGvlnvvhGdkeavdrllehpdvkavsfvGsvavgeyiyetgsahgkrvqalaGaknhmvvl 254
                                                     p+Gvl vvhGdk avd l+e p+vka+sfvGs++++eyiy  g+++gkrvqal+Gaknh+v++
                                                     *************************************************************** PP

                                       TIGR01722 255 pdadkeaaldalvgaavGaaGqrcmaisaavlvGaa..kelveeireraekvrvgagddpgae 315
                                                     pdad+++a++al+gaa+G+ G+rcmais+av vG+   + lv +++ +++ +++gag+  g +
                                                     **********************************855699*********************** PP

                                       TIGR01722 316 lGplitkqakervasliasgakeGaevlldGrgykveGyeeGnfvGitllervkpdmkiykee 378
                                                     +Gpl+t q++++v+ +i++g+  Ga++++dGrg+ v G+eeG f+G +l++rv p+m+iykee
                                                     *************************************************************** PP

                                       TIGR01722 379 ifGpvlvvleadtleeaiklinespyGnGtaiftsdGaaarkfqheievGqvGvnvpipvplp 441
                                                     ifGpvl+++++++leea++lin+  yGnGt+ift+dG aar f  eievG+vGvnvp+pvp++
                                                     *************************************************************** PP

                                       TIGR01722 442 ffsftGwkdslfGdlhiyGkqGvrfytrlktvtarw 477
                                                     ++sf+Gwk slfGdlh+yG +Gvrfytr k++t rw
  lcl|FitnessBrowser__pseudo5_N2C3_1:AO356_07950 446 YHSFGGWKRSLFGDLHAYGPDGVRFYTRRKAITQRW 481
                                                     ************************************ PP

Internal pipeline statistics summary:
Query model(s):                            1  (477 nodes)
Target sequences:                          1  (497 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 7.92

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory