Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate AO356_28585 AO356_28585 ABC transporter
Query= uniprot:D8IPI1 (406 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28585 Length = 379 Score = 298 bits (764), Expect = 1e-85 Identities = 163/343 (47%), Positives = 214/343 (62%), Gaps = 6/343 (1%) Query: 15 GGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGTLRIGGTVVNDLPAR 74 GG +L + L I GEFVV +GPSGCGKST+LR+IAGL+ I GG L I G VNDL R Sbjct: 14 GGARILRDVSLEISAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLLIDGRRVNDLEPR 73 Query: 75 ERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAALLNLEALLERKPRA 134 ER V MVFQ+YALYPHMSVYDNI+FGL+ K + RV + A +L L+ LL+RKPR Sbjct: 74 ERGVGMVFQSYALYPHMSVYDNISFGLKLAKTEKTSLRERVLKTAQILQLDKLLQRKPRE 133 Query: 135 MSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRLHQRLRTTTVYVTHD 194 +SGGQ+QR A+ RA+ + P + LFDEPLSNLDA LR Q+R +I RLH RL +T +YVTHD Sbjct: 134 LSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLHGRLGSTMIYVTHD 193 Query: 195 QLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAMNFLSGTVQRQDGQL 254 Q+EAMTLAD+++++ GRI Q GSP ELY P + F AGF+G+P MNFL+ + Sbjct: 194 QVEAMTLADKIVVLNGGRIEQVGSPRELYERPASRFVAGFLGSPRMNFLAAFLHTPGETS 253 Query: 255 FIETAHQRWALTGERFSRLRHAMAVKLAVRPDHVRIAGEREPAASLTCPVSVELVEILGA 314 +E+ S L + L +RP+H+ + AA T ++V VE LG+ Sbjct: 254 QVESLVLGMTSLPFDSSGLAANTQLSLGIRPEHIAL-----KAAQGTAGIAVSGVEYLGS 308 Query: 315 DALLTTRCG-DQTLTALVPADRLPQPGATLTLALDQHELHVFD 356 + + G D + + + G + L LD LHVFD Sbjct: 309 ETYVHLDTGQDDPMVCRCEVNAGWRVGDRVELQLDIDNLHVFD 351 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 379 Length adjustment: 31 Effective length of query: 375 Effective length of database: 348 Effective search space: 130500 Effective search space used: 130500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory