Align Putative xylitol transport system substrate-binding protein; SubName: Full=Sugar ABC transporter substrate-binding protein (characterized, see rationale)
to candidate AO356_29225 AO356_29225 rhizopine-binding protein
Query= uniprot:A0A1N7UEK0 (335 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_29225 Length = 308 Score = 162 bits (409), Expect = 1e-44 Identities = 88/263 (33%), Positives = 152/263 (57%), Gaps = 8/263 (3%) Query: 29 YKVGAAVYGLKGQFMQNWVRELKEHPAVKDGTVQLTVFDGNYDALTQNNQIENMVTQRYD 88 Y++G ++ + FM +VR + A K+ VQ+ D D + Q NQ++ + Q+ D Sbjct: 23 YRIGVSIARVDDNFM-TYVRNGLDEAAKKEN-VQIQFEDAQGDVVRQLNQVQGFINQKVD 80 Query: 89 AILFVPIDTKAGVGTVKAAMSNDVVVIASNTKVADASVPY----VGNDDVEGGRLQAQAM 144 A++ +P+DT A +AA+ ++ N + ++P V ++D+E G+LQ + + Sbjct: 81 AVIVLPVDTSATANITRAAVEAKTPLVYVNRHPDERTLPKGVVTVASNDIEAGQLQMRYL 140 Query: 145 VDKLNGKGNVVIIQGPIGQSAQIDREKGELEVLGKHPDIKIIEKKTANWDRAQALALTED 204 +KL GKGN+ II G + Q+A DR +G +VL +P IKI+E+++A W R + + LT + Sbjct: 141 AEKLGGKGNLAIIMGDLAQNATHDRTEGVKQVLKDYPGIKIVEQQSAEWQRNKGMDLTSN 200 Query: 205 WLNAHPKGINGVIAQNDDMALGAVQALKSHGLTSKDVPVTSIDGMPDAIQAAKKDE-VTT 263 WL A + + ++A ND+MA+GA AL+ G +V + IDG+PD + A K+ V + Sbjct: 201 WLLAGSR-FDAIVANNDEMAIGAAMALQQAGKAKGEVAIVGIDGLPDGLAAIKRGMLVAS 259 Query: 264 FLQDAQAQSQGALDVALRALAGK 286 QD +AQ+ A+ AL+ + G+ Sbjct: 260 VFQDPKAQATSAVQAALKMIKGE 282 Lambda K H 0.314 0.130 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 308 Length adjustment: 28 Effective length of query: 307 Effective length of database: 280 Effective search space: 85960 Effective search space used: 85960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory