Align ABC-type transporter, integral membrane subunit, component of Xylose porter (Nanavati et al. 2006). Regulated by xylose-responsive regulator XylR (characterized)
to candidate AO356_20255 AO356_20255 arabinose ABC transporter permease
Query= TCDB::Q9WXW7 (317 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_20255 Length = 322 Score = 196 bits (498), Expect = 6e-55 Identities = 105/298 (35%), Positives = 173/298 (58%), Gaps = 2/298 (0%) Query: 16 LVALVSLAVFTAILNPRFLTAFNLQALGRQIAIFGLLAIGETFVIISGGGAIDLSPGSMV 75 L+A + + V ++ FL+ N++ LG I+ G+ A + + SG DLS GS++ Sbjct: 27 LLAAIGIFVLCTLMIDNFLSPLNMRGLGLAISTTGIAACTMLYCLASGH--FDLSVGSVI 84 Query: 76 ALTGVMVAWLMTHGVPVWISVILILLFSIGAGAWHGLFVTKLRVPAFIITLGTLTIARGM 135 A GV+ A +M V++ V L + G +G+ + KLRV A I TL T+ I RG+ Sbjct: 85 ACAGVVAAVVMRDTNSVFLGVSAALAMGLIVGLINGIVIAKLRVNALITTLATMQIVRGL 144 Query: 136 AAVITKGWPIIGLPSSFLKIGQGEFLKIPIPVWILLAVALVADFFLRKTVYGKHLRASGG 195 A + G + SF G G+ +P+P+ I +A L + L T YG++ A GG Sbjct: 145 AYIFANGKAVGVSQESFFVFGNGQLFGVPVPILITIACFLFFGWLLNYTTYGRNTMAIGG 204 Query: 196 NEVAARFSGVNVDRVRMIAFMVSGFLAGVVGIIIAARLSQGQPGVGSMYELYAIASTVIG 255 N+ AA +GVNVDR ++I F V G + + G+I+A+R++ GQP +G +EL I++ V+G Sbjct: 205 NQEAALLAGVNVDRTKIIIFAVHGLIGALAGVILASRMTSGQPMIGQGFELTVISACVLG 264 Query: 256 GTSLTGGEGSVLGAIVGASIISLLWNALVLLNVSTYWHNVVIGIVIVVAVTLDILRRR 313 G SL+GG G + I G I++++ NA+ L N+ T++ V+ G ++++AV +D L++R Sbjct: 265 GVSLSGGIGMIRHVIAGVLILAIIENAMNLKNIDTFYQYVIRGSILLLAVVIDRLKQR 322 Lambda K H 0.328 0.143 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 322 Length adjustment: 28 Effective length of query: 289 Effective length of database: 294 Effective search space: 84966 Effective search space used: 84966 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory