Align Ribose import ATP-binding protein RbsA 1; EC 7.5.2.7 (characterized, see rationale)
to candidate AO356_28510 AO356_28510 xylose transporter
Query= uniprot:Q9WXX0 (520 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28510 Length = 518 Score = 340 bits (872), Expect = 7e-98 Identities = 202/508 (39%), Positives = 313/508 (61%), Gaps = 27/508 (5%) Query: 14 ILKAKGIVKRFPGVVAVDNVDFEVYENEIVSLIGENGAGKSTLIKILTGVLKPDA--GEI 71 +L+ GIVK F GV A++ +D +V E V L GENGAGKSTL+K+L+ V GEI Sbjct: 5 LLQMNGIVKTFGGVKALNGIDIKVRPGECVGLCGENGAGKSTLMKVLSAVYPHGTWEGEI 64 Query: 72 LVNGERVEFHSPVDAFKKGISVIHQELNLCDNMTVAENIFLAYEAVRGQKRTLSSRVDEN 131 + +G+ ++ S + GI +IHQEL L +++VAENIF+ +E R++ Sbjct: 65 IWDGQPLKAQSISETEAAGIVIIHQELTLVPDLSVAENIFMGHELTLP-----GGRMNYP 119 Query: 132 YMYTRSKELL-DLIGAKFSPDALVRNLTTAQRQMVEICKALVKEPRIIFMDEPTSSLTVE 190 M R++ L+ +L + V +Q+VEI KAL K+ R++ +DEP+S+LT Sbjct: 120 AMIHRAEALMRELKVPDMNVSLPVSQYGGGYQQLVEIAKALNKQARLLILDEPSSALTRS 179 Query: 191 ETERLFEIIEMLKSRGISVVFVSHRLDEVMRISDRIVVMRDGKRIGELKKGEFDVDTIIK 250 E E L +II LK++G++ V++SH+LDEV + D I V+RDGK I + D+ II Sbjct: 180 EIEVLLDIIRDLKAKGVACVYISHKLDEVAAVCDTISVIRDGKHIATTAMTDMDIPKIIT 239 Query: 251 MMVGREVEFF----PHGIETRPGEIALEVRNLKWKD-------KVKNVSFEVRKGEVLGF 299 MVGRE+ PH I GE+ E R++ D +V ++SF +++GE+LG Sbjct: 240 QMVGREMSNLYPTEPHDI----GEVIFEARHVTCYDVDNPRRKRVDDISFVLKRGEILGI 295 Query: 300 AGLVGAGRTETMLLVFGVNQ-KESGDIYVNGRKVEIKNPEDAIKMGIGLIPEDRKLQGLV 358 AGLVGAGRTE + +FG + G++++NG++++ + P +I+ G+ ++PEDRK QG++ Sbjct: 296 AGLVGAGRTELVSALFGAYPGRYEGEVWLNGQQIDTRTPLKSIRAGLCMVPEDRKRQGII 355 Query: 359 LRMTVKDNIVLPSLKKISRWGLVLDERKEEEISEDYVKRLSIKTPSIYQITENLSGGNQQ 418 + V NI L L S+ + E + I ++ + R+ +KT S + +LSGGNQQ Sbjct: 356 PDLGVGQNITLAVLDNYSKLTRIDAEAELGSIDKE-IARMHLKTASPFLPITSLSGGNQQ 414 Query: 419 KVVLAKWLATNADILIFDEPTRGIDVGAKAEIHRMIRELAAQGKAVIMISSELPEILNLS 478 K VLAK L T +LI DEPTRG+DVGAK EI++++ LAA+G ++IM+SSEL E+L +S Sbjct: 415 KAVLAKMLLTKPRVLILDEPTRGVDVGAKYEIYKLMGALAAEGVSIIMVSSELAEVLGVS 474 Query: 479 DRIVVMWEGEITAVLDNREKRVTQEEIM 506 DR++V+ +G++ N E +TQE+++ Sbjct: 475 DRVLVIGDGQLRGDFINHE--LTQEQVL 500 Lambda K H 0.319 0.138 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 705 Number of extensions: 43 Number of successful extensions: 10 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 520 Length of database: 518 Length adjustment: 35 Effective length of query: 485 Effective length of database: 483 Effective search space: 234255 Effective search space used: 234255 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory