GapMind for catabolism of small carbon sources

 

Protein Pf6N2E2_2889 in Pseudomonas fluorescens FW300-N2E2

Annotation: FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2889

Length: 386 amino acids

Source: pseudo6_N2E2 in FitnessBrowser

Candidate for 43 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-cellobiose catabolism gtsD hi ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 91% 100% 696.8 ABC transporter for D-Glucosamine, ATPase component 51% 354.4
D-galactose catabolism PfGW456L13_1897 hi ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 91% 100% 696.8 ABC transporter for D-Glucosamine, ATPase component 51% 354.4
D-glucose catabolism gtsD hi ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 91% 100% 696.8 ABC transporter for D-Glucosamine, ATPase component 51% 354.4
lactose catabolism gtsD hi ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 91% 100% 696.8 ABC transporter for D-Glucosamine, ATPase component 51% 354.4
D-maltose catabolism gtsD hi ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 91% 100% 696.8 ABC transporter for D-Glucosamine, ATPase component 51% 354.4
sucrose catabolism gtsD hi ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 91% 100% 696.8 ABC transporter for D-Glucosamine, ATPase component 51% 354.4
trehalose catabolism gtsD hi ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 91% 100% 696.8 ABC transporter for D-Glucosamine, ATPase component 51% 354.4
D-xylose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 89% 100% 677.9 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-glucosamine (chitosamine) catabolism SM_b21216 med ABC transporter for D-Glucosamine, ATPase component (characterized) 51% 99% 354.4 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 50% 99% 347.8 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
trehalose catabolism thuK med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 50% 99% 347.8 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-maltose catabolism malK_Aa med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 46% 100% 337.8 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-maltose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 48% 100% 337 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-mannose catabolism TT_C0211 med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 48% 100% 337 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
sucrose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 48% 100% 337 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-cellobiose catabolism SMc04256 med ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 48% 100% 332 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
xylitol catabolism HSERO_RS17020 med ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 47% 90% 326.2 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 47% 100% 325.1 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
lactose catabolism lacK med ABC transporter for Lactose, ATPase component (characterized) 48% 99% 315.5 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-mannitol catabolism mtlK med ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized) 46% 98% 314.7 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-maltose catabolism malK_Sm med MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 45% 100% 312.8 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
trehalose catabolism malK med MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 45% 100% 312.8 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-sorbitol (glucitol) catabolism mtlK med MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 46% 98% 311.2 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 45% 100% 308.5 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 45% 100% 305.8 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 45% 100% 305.1 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
L-arabinose catabolism xacK med Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 47% 100% 302.4 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-maltose catabolism malK med ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 44% 98% 296.2 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
L-arabinose catabolism xacJ med Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 44% 95% 282.7 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 56% 71% 282.3 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 47% 82% 281.2 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 47% 82% 281.2 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-maltose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 43% 99% 280.8 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
sucrose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 43% 99% 280.8 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
trehalose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 43% 99% 280.8 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-cellobiose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 45% 95% 278.5 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-glucose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 45% 95% 278.5 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
lactose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 45% 95% 278.5 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
D-maltose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 45% 95% 278.5 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
sucrose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 45% 95% 278.5 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
trehalose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 45% 95% 278.5 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 42% 92% 237.3 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8
glycerol catabolism glpT lo ABC transporter for Glycerol, ATPase component 2 (characterized) 36% 89% 201.4 ABC transporter for D-Galactose and D-Glucose, ATPase component 91% 696.8

Sequence Analysis Tools

View Pf6N2E2_2889 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MATLELRNVNKTYGVGLPDTLKNIELSIKDGEFLILVGPSGCGKSTLMNCIAGLETITGG
AIMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMNQAAIDEEVTRVA
KLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL
MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYTNPANLFVASFIGSPP
MNFIPLRLQRKDGRLLALLDSGQARCELPMGMQDAGLEDREVILGMRPEQIMLAGSEPNG
LPTIRAEVQVTEPTGPDTLVFVNLNDTKVCCRLAPDVAPQPGETLTLQFDPSKVLLFDAQ
SGERLGVAGQPQADARSANVAQFKGR

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory