Protein Pf6N2E2_3579 in Pseudomonas fluorescens FW300-N2E2
Annotation: High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)
Length: 304 amino acids
Source: pseudo6_N2E2 in FitnessBrowser
Candidate for 19 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
D-alanine catabolism | AZOBR_RS08235 | hi | L-proline and D-alanine ABC transporter, permease component 1 (characterized) | 58% | 99% | 351.7 | branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) | 56% | 335.5 |
L-proline catabolism | AZOBR_RS08235 | hi | L-proline and D-alanine ABC transporter, permease component 1 (characterized) | 58% | 99% | 351.7 | branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) | 56% | 335.5 |
L-isoleucine catabolism | livH | med | Branched-chain amino acid ABC transporter permease LivH; SubName: Full=Branched-chain amino acid transporter permease subunit LivH; SubName: Full=L-leucine ABC transporter membrane protein /L-isoleucine ABC transporter membrane protein /L-valine ABC transporter membrane protein (characterized, see rationale) | 55% | 98% | 336.3 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
L-phenylalanine catabolism | livH | med | Branched-chain amino acid ABC transporter permease LivH; SubName: Full=Branched-chain amino acid transporter permease subunit LivH; SubName: Full=L-leucine ABC transporter membrane protein /L-isoleucine ABC transporter membrane protein /L-valine ABC transporter membrane protein (characterized, see rationale) | 55% | 98% | 336.3 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
L-leucine catabolism | livH | med | branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) (characterized) | 56% | 98% | 335.5 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
L-valine catabolism | livH | med | branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) (characterized) | 56% | 98% | 335.5 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
L-alanine catabolism | braD | med | High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 55% | 98% | 332 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
L-serine catabolism | braD | med | High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 55% | 98% | 332 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
L-threonine catabolism | braD | med | High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 55% | 98% | 332 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
L-arginine catabolism | braD | med | Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) | 51% | 99% | 307 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
L-glutamate catabolism | braD | med | Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) | 51% | 99% | 307 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
L-histidine catabolism | braD | med | Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) | 51% | 99% | 307 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
L-proline catabolism | HSERO_RS00885 | med | ABC transporter permease (characterized, see rationale) | 48% | 98% | 268.5 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
L-serine catabolism | Ac3H11_1695 | med | ABC transporter permease (characterized, see rationale) | 48% | 98% | 268.5 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
L-tyrosine catabolism | Ac3H11_1695 | med | ABC transporter permease (characterized, see rationale) | 48% | 98% | 268.5 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
L-histidine catabolism | natD | lo | NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) | 31% | 98% | 141.7 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
L-leucine catabolism | natD | lo | NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) | 31% | 98% | 141.7 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
L-proline catabolism | natD | lo | NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) | 31% | 98% | 141.7 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
D-lactate catabolism | PGA1_c12660 | lo | D-lactate transporter, permease component 2 (characterized) | 31% | 74% | 109 | L-proline and D-alanine ABC transporter, permease component 1 | 58% | 351.7 |
Sequence Analysis Tools
View Pf6N2E2_3579 at FitnessBrowser
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Search PFam (including for weak hits, up to E = 1)Predict protein localization: PSORTb (Gram negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the SEED with FIGfam search
Fitness BLAST: loading...
Sequence
MDGIFLQQLINGLTLGSVYGLIAIGYTMVYGIIGMINFAHGEVYMISAYLAAISLALLAY
FGIESFPLMILGTLVFTVVVTGVYGWVIERVAYKPLRNSTRLAPLISAIGISLILQNYAQ
ISQGARQQGVPTLLEGAMRLDIGSGFVQLTYTKIFILIAAFAGMAVLTYIIKYTKLGRMC
RATQQDRKMASILGINTDRVISYVFIIGAAMAALAGVLITMNYGTFDFYAGFIIGIKAFT
AAVLGGIGSLPGAMLGGIILGISESLFSGLINSDYKDVFSFSLLVLILIFRPQGLLGRPL
VAKV
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory