Align TRAP transporter, subunit DctQ (characterized, see rationale)
to candidate Pf6N2E2_1303 TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter
Query= uniprot:I7EY26 (225 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1303 Length = 186 Score = 71.6 bits (174), Expect = 9e-18 Identities = 43/113 (38%), Positives = 62/113 (54%), Gaps = 16/113 (14%) Query: 15 LEETLIALLLGLMTLITFANVVARFVFNSNILWALELTVFLFAWLVLLGASYAVKVHAHL 74 L + LI L + M L+ F NVV R+ FNS I + EL+ + F W++ LGA A+K AHL Sbjct: 11 LLKLLIVLCMVAMILLVFGNVVLRYAFNSGISVSEELSRWFFVWMIFLGALVALKDRAHL 70 Query: 75 GVDAILNMVSPGARRVIGLISVGCCLVFSLLLLKGAYDYWAVFADLPPTSGRW 127 G+D+++ + P +R+ CLV S LL+ Y W +F SG W Sbjct: 71 GMDSLVKRLPPTGKRI--------CLVISHLLM--LYICWLIF------SGSW 107 Lambda K H 0.327 0.142 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 91 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 225 Length of database: 186 Length adjustment: 21 Effective length of query: 204 Effective length of database: 165 Effective search space: 33660 Effective search space used: 33660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory