Align Alpha-ketoglutarate permease (characterized)
to candidate Pf6N2E2_2276 Permeases of the major facilitator superfamily
Query= SwissProt::P0AEX3 (432 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2276 Length = 432 Score = 221 bits (563), Expect = 3e-62 Identities = 131/374 (35%), Positives = 209/374 (55%), Gaps = 16/374 (4%) Query: 23 AIVGASSGNLVEWFDFYVYSFCSLYFAHIFFPSGNTTTQLLQTAGVFAAGFLMRPIGGWL 82 AI SGN +E FDF VY F + A FFP+ + L+ + F AGFLMRP+G Sbjct: 10 AIFRVVSGNFLEMFDFMVYGFYATAIAKTFFPADSAFASLMLSLATFGAGFLMRPLGAIF 69 Query: 83 FGRIADKHGRKKSMLLSVCMMCFGSLVIACLPGYETIGTWAPALLLLARLFQGLSVGGEY 142 G D+HGR+K +++++ MM G+++IAC+PGY T+G AP L+LL RL QG S G E Sbjct: 70 LGAYIDRHGRRKGLIITLAMMAAGTVLIACVPGYATLGVAAPLLVLLGRLLQGFSAGVEL 129 Query: 143 GTSATYMSEVAVEGRKGFYASFQYVTLIGGQLLALLVVVVLQHTMEDAALREWGWRIPFA 202 G + Y++E++ GRKGF+ S+Q + + A L+ V L H + + EWGWR+PF Sbjct: 130 GGVSVYLAEISTPGRKGFFVSWQSASQQAAVVFAGLLGVGLNHWLSPQEMGEWGWRVPFL 189 Query: 203 LGAVLAVVALWLRRQLDETSQQETRALKEAGS--LKGLWRNRRAFIMVLGFTAAGSLCFY 260 +G ++ +RR L+ET + + R + + S ++ + +N + + ++ FY Sbjct: 190 VGCMIVPAIFVIRRSLEETPEFQARKHRPSLSEIVRSIGQNFGIVLAGMALVVMTTVSFY 249 Query: 261 TFTTY---MQKYLVNTAGMHANVASGIMTAALFVFMLIQPLIGALSDKIGRRTSMLCFGS 317 T Y K +N + + A + + + + F ++ P++GALSDK+GR+ +L Sbjct: 250 LITAYTPTFGKAELNLSDLDALLVTVCIGLSNFFWL---PVMGALSDKVGRKPLLLGATV 306 Query: 318 LAAIFTVPILSALQNVSSPYAAFGLVMCALLIVSF-YTSISG---ILKAEMFPAQVRALG 373 LA + P LS L V++P +F ++ L +SF Y S +G + E+ P +VR G Sbjct: 307 LAILTAYPALSWL--VANP--SFSHLLIVELWLSFLYGSYNGAMVVALTEIMPVEVRTTG 362 Query: 374 VGLSYAVANAIFGG 387 L+Y++A A FGG Sbjct: 363 FSLAYSLATATFGG 376 Lambda K H 0.328 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 494 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 432 Length adjustment: 32 Effective length of query: 400 Effective length of database: 400 Effective search space: 160000 Effective search space used: 160000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory