Align Benzoate--CoA ligase; Benzoyl-CoA synthetase; EC 6.2.1.25 (characterized)
to candidate Pf6N2E2_1143 Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases
Query= SwissProt::Q8GQN9 (527 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1143 Length = 557 Score = 188 bits (477), Expect = 5e-52 Identities = 161/521 (30%), Positives = 243/521 (46%), Gaps = 22/521 (4%) Query: 20 ERYNAADDLIGRNLLAGRGGKTVYIDDAG--SYTYDELALRVNRCGSALRTTLGLQPKDR 77 E NA + R+ L GR D ++TY +L R + LR G+ D+ Sbjct: 29 EALNACVECCDRHALPGRIALFWEGRDGSDATWTYRDLQDNAARFANFLRAQ-GVGKGDK 87 Query: 78 VLVCVLDGIDFPTTFLGAIKGGVVPIAINTLLTESDYEYMLTDSAARVAVVSQELLPLFA 137 V + + L + G V + T E+ + S AR+ V + Sbjct: 88 VAGLLPRTAELLIVVLATWRIGAVYQPLFTAFGPKAIEHRVGSSGARIVVTDA----VNR 143 Query: 138 PMLGKVPTLEHLVVAGGA-------GEDSLAALLATGSEQFEAAPTRPDDHCFWLYSSGS 190 P L ++ +V GG G+ S A +A S Q E +D +++SG+ Sbjct: 144 PKLNEIAGCPTIVTVGGEKGQGIVRGDYSFWAEVANHSSQCEPLMLTGEDPFLLMFTSGT 203 Query: 191 TGAPKGTVHIHSDLIHTAELYARPILGIREGDVVFSAAKLFFAYGLGNGLIFPLAVGATA 250 TG P + + I + Y R + +R D ++ A +AYG+ G+ PLA+G Sbjct: 204 TG-PAKALSVPLKAIVAFQSYTRDAVDLRPEDAFWNVADPGWAYGIYFGVTGPLAMGHPI 262 Query: 251 VLMAERPTPAAVFERLRRHQPDIFYGVPTLYASMLANPD-CPKEGELRLRACTSAGEALP 309 T + + ++ G PT Y ++A + + + +LR +SAGE L Sbjct: 263 TFYDGPFTLESTCRVINKYGITNLTGSPTAYRLLIAGGEQFARSIKGKLRIVSSAGEPLN 322 Query: 310 EDVGRRWQARFGVDILDGIGSTEMLHIFLSNRAG---DVHYGTSGKPVPGYRLRLIDEDG 366 +V R + V I D G TE L + L N G VH G +G PG+R+ ++DE+ Sbjct: 323 PEVIRWFADNLNVVIHDHYGQTE-LGMVLCNHHGLEHPVHLGAAGFASPGHRIVVLDENQ 381 Query: 367 AEITTAGVAGELQISGPSSAVMYWNNPEKTAA-TFMGEWTRSGDKYLVNDEGYYVYAGRS 425 E+ G G L + S + ++ E F+G++ SGD +N +G + GRS Sbjct: 382 RELGV-GQPGILAVDRSQSPMCWFAGYEGAPTKAFVGDYYLSGDTVELNLDGSISFVGRS 440 Query: 426 DDMLKVSGIYVSPIEVESALIAHEAVLEAAVVGWEDEDHLIKPKAFIVLKPGYGAGEALR 485 DD++ SG V P +VESALI H AV+EAAV+G D + KAF+VL Y A L Sbjct: 441 DDVITTSGYRVGPFDVESALIEHPAVVEAAVIGKPDPERTELVKAFVVLSTQYRASPELA 500 Query: 486 TDLKAHVKNLLAPYKYPRWIEFVDDLPKTATGKIQRFKLRS 526 +L+ HV+ LA + YPR IEFV DLPKT +GK+QRF LR+ Sbjct: 501 EELRLHVRKRLAAHAYPREIEFVSDLPKTPSGKLQRFILRN 541 Lambda K H 0.319 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 780 Number of extensions: 44 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 527 Length of database: 557 Length adjustment: 35 Effective length of query: 492 Effective length of database: 522 Effective search space: 256824 Effective search space used: 256824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory