Align subunit of 3-oxoadipate enol-lactone hydrolase (EC 3.1.1.24) (characterized)
to candidate Pf6N2E2_2401 Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)
Query= metacyc::MONOMER-3221 (263 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2401 Length = 270 Score = 87.8 bits (216), Expect = 2e-22 Identities = 84/268 (31%), Positives = 121/268 (45%), Gaps = 15/268 (5%) Query: 4 LQLADGVLNYQIDGPDDAPVLVLSNSLGTDLGMWDTQIPLWSQHFRVLRYDTRGHGAS-L 62 + + DG Y +D PV++L S D MW QI + S+H+RV+ D GHG S Sbjct: 3 IAMIDGQPLYYLD-QGQGPVVLLGGSYLWDHAMWAPQIEVLSRHYRVIAPDLWGHGQSGQ 61 Query: 63 VTEGPYSIEQLGRDVLALLDGLDIQKAHFVGLSMGGLIGQWLGIHAGERLHSLTLCNTAA 122 + EG S+ L R ++ LLD L I H VGLS+GG+ G L + A R+ SL L +T Sbjct: 62 MPEGMSSLNDLARQMMELLDYLSIDCFHLVGLSVGGMWGTRLALAAPTRIQSLVLMDTYV 121 Query: 123 KIANDEV---WNTRIDTVLKGGQQAMVDLRDASIARWFTPGFAQAQAEQAQRICQMLAQT 179 + ++ + + D + G L D + +F PG A Q + A Sbjct: 122 GVEPEQTRQYYFSLFDKIEASG-SIPEPLLDIIVPIFFRPGIDPQSALYQQFRATLAALP 180 Query: 180 SPQGYA-----GNCAAVRDADYREQLGRIQVPALIV-AGTQDVVTTPEHGRFMQAGIQGA 233 S + A G RD D +L + +V G QD P R M A + G Sbjct: 181 SDRLRASIVPLGRIIFGRD-DILPRLHALDAKGTVVMCGDQDKPRPPSESREM-AELIGC 238 Query: 234 EYVDFP-AAHLSNVEIGEAFSRRVLDFL 260 +V P A H+SN+E E + +L FL Sbjct: 239 PHVVIPDAGHISNLENPEFVTGALLKFL 266 Lambda K H 0.321 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 270 Length adjustment: 25 Effective length of query: 238 Effective length of database: 245 Effective search space: 58310 Effective search space used: 58310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory