Align protocatechuate 3,4-dioxygenase type II β subunit (EC 1.13.11.3) (characterized)
to candidate Pf6N2E2_997 Catechol 1,2-dioxygenase 1 (EC 1.13.11.1)
Query= metacyc::MONOMER-14210 (241 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_997 Length = 242 Score = 68.6 bits (166), Expect = 1e-16 Identities = 48/140 (34%), Positives = 65/140 (46%), Gaps = 17/140 (12%) Query: 69 DLTKQGEGEPIGERIFVHGQVMDEDGRAIPNTLIEIWQANAAGRYIHALDSHPAPLDPNF 128 DL + G G FV G V +DG IPN IE+WQA+ AG Y P ++ Sbjct: 69 DLGEDISGGLPGVPWFVKGTVTAKDGTPIPNATIEVWQADDAGFY-----DVQKPDMGDY 123 Query: 129 YGAGRTVTADDGTYTFTTIKPGPYPI----------MGLNNY-WRPAHIHLSLFGPSFLT 177 +G +G Y F TI P YPI LN + WRPAH+H + P + Sbjct: 124 HGRAVIQADANGHYYFRTIVPECYPIPHDGPVGKMLEALNRHPWRPAHLHFMITAPGY-Q 182 Query: 178 RLVTQLYFEGDPLIQHDMIY 197 RLVT ++ EG + D ++ Sbjct: 183 RLVTHVFREGGDYLDSDAVF 202 Lambda K H 0.319 0.136 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 242 Length adjustment: 23 Effective length of query: 218 Effective length of database: 219 Effective search space: 47742 Effective search space used: 47742 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory