Align protocatechuate 3,4-dioxygenase, alpha chain; EC 1.13.11.3 (characterized)
to candidate Pf6N2E2_2833 Protocatechuate 3,4-dioxygenase alpha chain (EC 1.13.11.3)
Query= CharProtDB::CH_121294 (209 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2833 Length = 188 Score = 147 bits (370), Expect = 2e-40 Identities = 92/201 (45%), Positives = 119/201 (59%), Gaps = 17/201 (8%) Query: 9 LKETPSQTGGPYVHIGLLPKQANIEVFEHNLDNNLVQDNTQGQRIRLEGQVFDGLGLPLR 68 L T S T GPY HIGL N E +L T GQR+ + GQV DG G + Sbjct: 3 LTATTSHTVGPYYHIGLT--WLNRE--------DLTVAETLGQRVAITGQVVDGNGQFVN 52 Query: 69 DVLIEIWQADTNGVYPSQADTQGKQVDPNFLGWGRTGADFGTGFWSFNTIKPGAVPGRKG 128 D ++E+WQA+ G Y D Q K +DPNF G+GR D G + F TIKPG VPG G Sbjct: 53 DAMLEVWQANAAGKYAHPEDDQDKPLDPNFEGFGRVPVD-AEGRFRFTTIKPGTVPGLGG 111 Query: 129 STQAPHISLIIFARGINIGLHTRVYFDDEAEANAKDPVLNSIEWATRRQTLVAKREERDG 188 +TQAPH+ +++FARG+ L TR+YFD E +AN DP+L + RR T+VAK D Sbjct: 112 TTQAPHLVVLVFARGLVKHLLTRIYFDGE-QANETDPLLACVP-EERRGTIVAK---PDA 166 Query: 189 EVVYRFDIRIQG-ENETVFFD 208 VY++++ +QG E ETVFFD Sbjct: 167 SGVYQWNVILQGTEAETVFFD 187 Lambda K H 0.318 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 209 Length of database: 188 Length adjustment: 20 Effective length of query: 189 Effective length of database: 168 Effective search space: 31752 Effective search space used: 31752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory