Align 2-hydroxymuconate-6-semialdehyde hydrolase (EC 3.7.1.9) (characterized)
to candidate Pf6N2E2_5281 Alpha/beta hydrolase fold (EC 3.8.1.5)
Query= BRENDA::G3KFX4 (282 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5281 Length = 300 Score = 55.1 bits (131), Expect = 2e-12 Identities = 37/97 (38%), Positives = 51/97 (52%), Gaps = 4/97 (4%) Query: 27 GEGFPVLLIHGSGPGVTAWANWRLVMPQLAQNRRVIAPDMLGFGYSDRPADGRYHQQRWV 86 G+G P+LLIHG TA +W + LAQ RVIA DMLGFG S +P D Y Sbjct: 31 GQGEPLLLIHGFP---TASWDWHYLWQPLAQRYRVIACDMLGFGDSAKPTDHVYSLLEQA 87 Query: 87 EHAIGVLDALGIQQA-DIVGNSFGGGLALALAIRHPE 122 + +L L ++ A ++ + +G +A L RH E Sbjct: 88 DLQQALLAHLNVRGALHVLAHDYGDSVAQELLARHYE 124 Lambda K H 0.323 0.138 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 300 Length adjustment: 26 Effective length of query: 256 Effective length of database: 274 Effective search space: 70144 Effective search space used: 70144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory