Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate Pf6N2E2_1705 Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)
Query= uniprot:G8ALJ0 (294 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1705 Length = 256 Score = 182 bits (463), Expect = 5e-51 Identities = 108/260 (41%), Positives = 155/260 (59%), Gaps = 13/260 (5%) Query: 11 LLTVEHLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGFYTPTVGRLTL 70 LL V ++++ F G+ A++D+SFS GEI A+IGPNGAGK++L N + G Y G+L Sbjct: 4 LLEVRNVSLSFRGVKAISDLSFSVKLGEICALIGPNGAGKSSLLNILNGVYRADAGQLF- 62 Query: 71 RHADGKEFLLERM--PGYRISQKASVARTFQNIRLFGGMSVLENLIVAQHNKLIRASGFS 128 F E + P + + + RTFQN LF MSV++NL+ ++ R F Sbjct: 63 -------FAAEPLHRPHPLKAARLGIGRTFQNNALFKKMSVVDNLLTGL-SRFQRT--FF 112 Query: 129 IAGLLGLPSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIARAMCTEPV 188 + LGLP R R + A+ L+ + L + D G+L YG Q+R+E+ RA+ +P Sbjct: 113 LEQALGLPRARREARAFAERAERVLEFLELQAWRDVAVGSLAYGLQKRVELGRALIAQPT 172 Query: 189 MLCLDEPAAGLNPRESGELADLLTYIRDEHKIGVLLIEHDMSVVMTISDHVVVLDYGRKI 248 +L LDEP AG+N E +++ +T I + V+LIEHD+ VVM +S HVVVLDYGRK+ Sbjct: 173 LLLLDEPMAGMNAEEKQDMSRFITDINRDLGTTVILIEHDIQVVMGLSSHVVVLDYGRKV 232 Query: 249 SDGDPAFVKNDPAVIRAYLG 268 DG PA V+ +P VI AYLG Sbjct: 233 GDGSPAEVQVNPEVIAAYLG 252 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 256 Length adjustment: 25 Effective length of query: 269 Effective length of database: 231 Effective search space: 62139 Effective search space used: 62139 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory