GapMind for catabolism of small carbon sources

 

Aligments for a candidate for D-LDH in Pseudomonas fluorescens FW300-N2E2

Align D-2-hydroxyglutarate--pyruvate transhydrogenase DLD2; D-2HG--pyruvate transhydrogenase DLD2; Actin-interacting protein 2; D-lactate dehydrogenase [cytochrome] 2, mitochondrial; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 (characterized)
to candidate Pf6N2E2_3933 D-2-hydroxyglutarate dehydrogenase

Query= SwissProt::P46681
         (530 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3933 D-2-hydroxyglutarate
           dehydrogenase
          Length = 472

 Score =  290 bits (741), Expect = 1e-82
 Identities = 164/470 (34%), Positives = 267/470 (56%), Gaps = 23/470 (4%)

Query: 66  LNYFKSILSEQEILRASESEDLSFYNEDWMRKYKGQSKLVLRPKSVEKVSLILNYCNDEK 125
           ++  K+++   ++L  ++++ L+ Y +DW + +      ++ PK+ E+V  I+ + N+ K
Sbjct: 15  IDELKTLVEPGKVL--TDADSLNAYGKDWTKHFAPAPTAIVFPKTTEQVQAIVRWANEHK 72

Query: 126 IAVVPQGGNTGLVGGSVPIFDELILSLANLNKIRDFDPVSGILKCDAGVILENANNYVME 185
           +A+VP GG TGL   +V    E+++S   +N++ D +       C  GV+ E   N   E
Sbjct: 73  VALVPSGGRTGLSAAAVAANGEVVVSFDYMNQVLDVNLTDRTAVCQPGVVTEQLQNKAEE 132

Query: 186 QNYMFPLDLGAKGSCHVGGVVATNAGGLRLLRYGSLHGSVLGLEVVMPNGQIVNSMHSMR 245
               +P+D  + GS  +GG + TNAGG++++RYG     V G++VV   G ++     + 
Sbjct: 133 HGLYYPVDFASAGSSQIGGNIGTNAGGIKVIRYGMTRNWVAGMKVVTGKGDLLELNKDLI 192

Query: 246 KDNTGYDLKQLFIGSEGTIGIITGVSILTVPKPKAFNVSYLSVESFEDVQKVFVRARQEL 305
           K+ TGYDL+QLFIG+EGT+G +   ++     PK      L    F+ +  V    + +L
Sbjct: 193 KNATGYDLRQLFIGAEGTLGFVVEATMRLDRAPKNLTAMVLGTPDFDSIMPVLHAFQGKL 252

Query: 306 SEILSAFEFMDAK--SQVLAKSQLKDAAFPLEDEHPFYILIETSGSNKDHDDSKLETFLE 363
              L+AFEF   K  ++VLA+    D   P E E PFY L+E   + ++  +  LETF E
Sbjct: 253 D--LTAFEFFSDKALAKVLARG---DVPAPFETECPFYALLEFEATTEEVANHALETF-E 306

Query: 364 NVMEEGIVTDGVVAQDETELQNLWKWREMIPEASQANGGVYKYDVSLPLKDLYSLVEATN 423
           + +E+G V DGV++Q ET+LQNLWK RE I E + ++   YK D+S+ +  +   +   +
Sbjct: 307 HCVEQGWVLDGVMSQSETQLQNLWKLREYISE-TISHWTPYKNDISVTVSKVPGFLREID 365

Query: 424 ARLSEAELVGDSPKPVVGAIGYGHVGDGNLHLNVAVREYNKNIE-----KTLEPFVYEFV 478
           A      +VG+   P    + +GH+GDGNLHLN+   E     E      T+  +V+E V
Sbjct: 366 A------IVGEH-YPDFEIVWFGHIGDGNLHLNILKPENLSKDEFFAKCATVNKWVFETV 418

Query: 479 SSKHGSVSAEHGLGFQKKNYIGYSKSPEEVKMMKDLKVHYDPNGILNPYK 528
              +GS+SAEHG+G  K++Y+ YS+SP E++ MK +K  +DPNGI+NP K
Sbjct: 419 EKYNGSISAEHGVGMTKRDYLTYSRSPVEIEYMKAVKAVFDPNGIMNPGK 468


Lambda     K      H
   0.316    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 538
Number of extensions: 23
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 530
Length of database: 472
Length adjustment: 34
Effective length of query: 496
Effective length of database: 438
Effective search space:   217248
Effective search space used:   217248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory