Align D-lactate transporter, ATP-binding component (characterized)
to candidate Pf6N2E2_186 Urea ABC transporter, ATPase protein UrtD
Query= reanno::Phaeo:GFF1248 (251 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_186 Length = 252 Score = 170 bits (430), Expect = 3e-47 Identities = 97/248 (39%), Positives = 144/248 (58%), Gaps = 10/248 (4%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 +L ++ + F G +A+ ++NL + N V +IGPNGAGK+T+L+ + GK +GS+ F Sbjct: 12 VLVIEGLTVSFDGFKAVDNLNLYIDRNEVRVVIGPNGAGKTTVLDLICGKTRATSGSIQF 71 Query: 63 DGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLEN--MMIPCFAKRDGAFEMNAISAVS 120 DGK + Y I + G+ R FQ P I+ +L+V EN M P K GA +AV Sbjct: 72 DGKELTKMREYNIVRAGVGRKFQNPSIYENLTVFENLEMSYPAGRKVFGALFFKRSAAV- 130 Query: 121 GQRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMA 180 + + E + E+ + + A +S G K+ LEIGM L Q+P LL+LDEP AGM+ Sbjct: 131 -----IARVEEVAREIFLGELLQQQADLLSHGQKQWLEIGMLLMQDPDLLMLDEPVAGMS 185 Query: 181 RADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNP 240 + T +LLK+I R ++ +IEHDM V S+A ++TVL QG L E ++++ NP Sbjct: 186 VNERVQTAELLKRISQGR--SVLVIEHDMEFVKSIAHKVTVLHQGKVLAEGSMESVQNNP 243 Query: 241 KVREAYLG 248 KV E YLG Sbjct: 244 KVIEVYLG 251 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 252 Length adjustment: 24 Effective length of query: 227 Effective length of database: 228 Effective search space: 51756 Effective search space used: 51756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory