Align Glucose kinase (characterized, see rationale)
to candidate Pf6N2E2_2897 Glucokinase (EC 2.7.1.2)
Query= uniprot:Q8P6M4 (344 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2897 Length = 319 Score = 136 bits (343), Expect = 6e-37 Identities = 98/312 (31%), Positives = 147/312 (47%), Gaps = 9/312 (2%) Query: 23 LAADVGGTHVRVGRVSHGADAPIELSQYRTYRCADHASLDAILADFLRDSRAVDAVVIAS 82 L D+GGT+ R + I++ Y C + A + L+ A+ +V ++ Sbjct: 5 LVGDIGGTNARFALWKNHTLENIQVLATADYACPEDA-IQVYLSGLGLKQGAIGSVCLSV 63 Query: 83 AG-VALDDGRFISNNLPWTIAPRQLRDTLGVRAVHLVNDFEAVAYAAPQMEQRAVVQLSG 141 AG V+ D+ RF +N+ W ++ TL V + LVNDF A+A + + Sbjct: 64 AGPVSGDEFRFTNNH--WRLSNLAFCQTLQVEKLLLVNDFSAMALGMTCLRPDEYRVVCE 121 Query: 142 PTPRHAQPGGPILVVGPGTGLGAAVWIN-GPRQPTVLATEAGQVALASNDPDTAQVLRIL 200 TP +P P +V+GPGTGLG ++ G + L E G V L + P Q+ + + Sbjct: 122 GTP---EPLRPAVVIGPGTGLGVGTLLDLGEGRFAALPGEGGHVDLPLSSPRETQLWQHI 178 Query: 201 ARDASYLPIEHVLSGPGLRNLYLALCELHAATPIHPLPADITHAALHSDDALARRCLQLF 260 + ++ E LSG GL +Y A+C + P+ P IT A L + D +A L+ F Sbjct: 179 YNEIGHVSAETALSGSGLPRVYRAICAVDGHVPVLDTPESITAAGL-AGDPIALEVLEQF 237 Query: 261 CALLGSAVGDMALAYGASGGVYLAGGILPSIGQFLAASDFRERFLAKGRMRPVLERIPVK 320 C LG G+ L G GGVY+ GG++P F S F F KG M + IPV Sbjct: 238 CRWLGRVAGNNVLTLGGRGGVYIVGGVVPRFADFFLESGFARCFADKGCMSDYFKGIPVW 297 Query: 321 LVEHGQLGVLGA 332 LV G++GA Sbjct: 298 LVTAPYPGLMGA 309 Lambda K H 0.321 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 319 Length adjustment: 28 Effective length of query: 316 Effective length of database: 291 Effective search space: 91956 Effective search space used: 91956 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory