Align Acetate/monochloroacetate permease, Deh4p, of 468 aas and 12 TMSs (characterized)
to candidate Pf6N2E2_3153 Permeases of the major facilitator superfamily
Query= TCDB::M1Q159 (468 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3153 Length = 437 Score = 224 bits (572), Expect = 3e-63 Identities = 149/455 (32%), Positives = 230/455 (50%), Gaps = 41/455 (9%) Query: 5 SSPPTPKGIWKVIFASSAGTVIEWYDFYIFG-ALATTLASKFYNTGTPIGDIIAWLGTFA 63 S+ PT +V AS GT IE+YDFY++ A A + F+ + +++ TF Sbjct: 11 SAQPT-NSTTRVATASFIGTAIEFYDFYVYATAAALVIGPVFFPQTSGTAQMLSSFLTFG 69 Query: 64 VGFLVRPFGAIVFGRIGDLVGRKFTYLITITIMGSCTFLIGLLPTQDVLGAWAGIILITM 123 + FL RP G+ +FG GD +GRK T + ++ +MG CT LIG+LP +GAWA I+L + Sbjct: 70 IAFLARPLGSALFGHFGDRIGRKSTLVASLLLMGVCTTLIGVLPGYASIGAWAPILLCVL 129 Query: 124 RILQGLALGGQYGGAATFVAEHAPQGKRGFYTSWIQTTATFGLLISLGVILITRISLGEA 183 R QGL LGG++GGAA E+AP+GKR ++ + Q + G L + G+ L + L + Sbjct: 130 RFGQGLGLGGEWGGAALLATENAPKGKRAWFGMFPQLGPSIGFLAANGLFLTLAMGLDDE 189 Query: 184 DFNEWGWRLPFMASILLVILSLWIRRALKESPLFQQLKDTKAVSKNPLKESFANPYNLRW 243 F WGWR+PF+ S +LVI+ L++R L E+P+F + K PL E F+ W Sbjct: 190 QFRAWGWRIPFLLSAVLVIVGLYVRLKLHETPVFANAMARQERVKVPLVELFSQ----YW 245 Query: 244 VLIALFGATMGQGVVWYTGQFYALFYLQKIFNTPLIDSNLIVGAALLLS-MPFFVFFGS- 301 L A M VV YALFY+ +F+ S L L + F V F + Sbjct: 246 APTLLGAAAM---VV-----CYALFYISTVFSLSYGVSTLGYSRETFLGLLCFAVLFMAA 297 Query: 302 -------LSDRIGRKKVMLSGMLLAVLTYYPIYGLMAAFAPTDPGQHFLFAYIGYNPVIL 354 SDR GRK V++ G +LA+ + + + L+ + + + Sbjct: 298 ATPLSAWASDRYGRKPVLIGGGVLAIASGFLMEPLLTHGSTSG----------------V 341 Query: 355 GLLVFIQVIYVTMVYGPIAAFLVELFPTKIRYTSMSLPYHIGNGVFGGLVPMIGLILINA 414 L + I++ + + + P+ A L ELFPT +RYT S Y++G V P L+ Sbjct: 342 ALFLCIELFLMGVTFAPMGALLPELFPTHVRYTGASAAYNLGGIVGASAAPFFAQKLVAM 401 Query: 415 TGNDFAGLWWPMAIAGICLVVGFLLIKETNKVDIS 449 G + G + ++ A + V+ L +KET D++ Sbjct: 402 GGLSYVGGY--VSGAAVLSVIAVLCLKETRHNDLN 434 Lambda K H 0.328 0.144 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 611 Number of extensions: 36 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 468 Length of database: 437 Length adjustment: 33 Effective length of query: 435 Effective length of database: 404 Effective search space: 175740 Effective search space used: 175740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory