Align Periplasmic binding protein/LacI transcriptional regulator (characterized, see rationale)
to candidate Pf6N2E2_1005 Ribose ABC transport system, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)
Query= uniprot:A0KWY4 (313 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1005 Length = 317 Score = 121 bits (303), Expect = 2e-32 Identities = 75/227 (33%), Positives = 119/227 (52%), Gaps = 5/227 (2%) Query: 42 EAVKAEAKQRGIDLKFADAQQKQENQIKAVRSFIAQGVDAIIIAPVVETGWKPVLKEAKR 101 E EAK ++L DAQ Q V + + QGVDA+++AP T P L E Sbjct: 49 EQASQEAKVLNVELLVQDAQSSSTKQSSDVENALTQGVDAMVVAPNDVTALAPALNEVLS 108 Query: 102 AKIPVVIVDRNIKVDDDSLFLTRIASDFSEEGRKIGQWLMDKTQGNCDIAELQGTVGATA 161 K+P+V VDR ++ D + + +D GR + + + + +A + GT G++ Sbjct: 109 EKVPLVTVDRRVEGTDTP--VPYVTADSVAGGRLMAELVTSNMKNGARVAFIGGTPGSST 166 Query: 162 AIDRAAGFNQVI-ANYPNAKIVRSQTGEFTRAKGKEVMEGFLKAQNGQPLCAVWSHNDEM 220 AIDRA G ++ + A ++V Q+GE+ RAK V E L + + P A+ + +M Sbjct: 167 AIDRAKGVHEGLKAGGGKFQLVAEQSGEWERAKAMSVAENILTSLSANPPDAIICASGDM 226 Query: 221 ALGAVQAIKEAGLKPGKDILIVSVDGVPDYFKAMADGDVNATVELSP 267 ALGA +A++ GLK GK + ++ D P+ +A+ DGD+ VE SP Sbjct: 227 ALGAAEAVRATGLK-GK-VKVIGFDAYPEVLRAIRDGDIAGIVEQSP 271 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 317 Length adjustment: 27 Effective length of query: 286 Effective length of database: 290 Effective search space: 82940 Effective search space used: 82940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory