Align Ornithine carbamoyltransferase, catabolic; OTCase; EC 2.1.3.3 (characterized)
to candidate Pf6N2E2_2909 Ornithine carbamoyltransferase (EC 2.1.3.3)
Query= SwissProt::P08308 (336 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2909 Length = 336 Score = 597 bits (1539), Expect = e-175 Identities = 289/336 (86%), Positives = 315/336 (93%) Query: 1 MAFNMHNRNLLSLMHHSTRELRYLLDLSRDLKRAKYTGTEQQHLKRKNIALIFEKTSTRT 60 MAFNM NR+LLSLMHH+ REL +LLDLSRDLKRAKYTGTEQ HLK KNIALIFEKTSTRT Sbjct: 1 MAFNMRNRSLLSLMHHTNRELHFLLDLSRDLKRAKYTGTEQPHLKGKNIALIFEKTSTRT 60 Query: 61 RCAFEVAAYDQGANVTYIDPNSSQIGHKESMKDTARVLGRMYDAIEYRGFKQEIVEELAK 120 RCAFEVAA+DQGA+VTYIDP SSQIGHKESMKDTARVLGRM+DAIEYRGF+QEIVEELAK Sbjct: 61 RCAFEVAAHDQGAHVTYIDPVSSQIGHKESMKDTARVLGRMFDAIEYRGFEQEIVEELAK 120 Query: 121 FAGVPVFNGLTDEYHPTQMLADVLTMREHSDKPLHDISYAYLGDARNNMGNSLLLIGAKL 180 FAGVPVFNGLT E+HPTQM+AD LTMREHSDKPLHDISYAYLGDAR NMGNSLL+IGAKL Sbjct: 121 FAGVPVFNGLTAEFHPTQMIADTLTMREHSDKPLHDISYAYLGDARYNMGNSLLMIGAKL 180 Query: 181 GMDVRIAAPKALWPHDEFVAQCKKFAEESGAKLTLTEDPKEAVKGVDFVHTDVWVSMGEP 240 GMDVRI APKALWPH +F+ QC+ FA ESGA++T+TEDPKEAVKGVDF+HTD+WVSMGEP Sbjct: 181 GMDVRIGAPKALWPHQDFIDQCQAFAVESGARITITEDPKEAVKGVDFIHTDIWVSMGEP 240 Query: 241 VEAWGERIKELLPYQVNMEIMKATGNPRAKFMHCLPAFHNSETKVGKQIAEQYPNLANGI 300 VEAW ERI++LLPYQVN ++MKA+GNPR KFMHCLPAFHNSETKVGK IA +YPNLANG+ Sbjct: 241 VEAWDERIEQLLPYQVNAQMMKASGNPRVKFMHCLPAFHNSETKVGKDIAARYPNLANGV 300 Query: 301 EVTEDVFESPYNIAFEQAENRMHTIKAILVSTLADI 336 EVTE+VFESP NIAFEQAENRMHTIKAILVS LADI Sbjct: 301 EVTEEVFESPANIAFEQAENRMHTIKAILVSALADI 336 Lambda K H 0.318 0.133 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 487 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 336 Length adjustment: 28 Effective length of query: 308 Effective length of database: 308 Effective search space: 94864 Effective search space used: 94864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate Pf6N2E2_2909 (Ornithine carbamoyltransferase (EC 2.1.3.3))
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00658.hmm # target sequence database: /tmp/gapView.2056762.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-131 423.9 0.0 1.9e-131 423.7 0.0 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2909 Ornithine carbamoyltransferase ( Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2909 Ornithine carbamoyltransferase (EC 2.1.3.3) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 423.7 0.0 1.9e-131 1.9e-131 1 303 [. 8 333 .. 8 334 .. 0.99 Alignments for each domain: == domain 1 score: 423.7 bits; conditional E-value: 1.9e-131 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayel 64 r+llsl++++++el+ ll+l+++lk++k++g+e+ +lkgk++aliFek+stRtR++fevaa ++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2909 8 RSLLSLMHHTNRELHFLLDLSRDLKRAKYTGTEQPHLKGKNIALIFEKTSTRTRCAFEVAAHDQ 71 78************************************************************** PP TIGR00658 65 GaqvlylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdleh 128 Ga+v+y+++ ++q+g+kes+kDtarvl+r++dai +R++++e+veelak+a+vPv+ngLt ++h lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2909 72 GAHVTYIDPVSSQIGHKESMKDTARVLGRMFDAIEYRGFEQEIVEELAKFAGVPVFNGLTAEFH 135 **************************************************************** PP TIGR00658 129 PcqilaDlltikeklg.klkevklvyvGDa.nnvanslllaaaklGldvvvatPeglepeaeiv 190 P+q++aD lt++e+ + l++++++y+GDa n++nsll+++aklG+dv++ +P++l+p+++ + lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2909 136 PTQMIADTLTMREHSDkPLHDISYAYLGDArYNMGNSLLMIGAKLGMDVRIGAPKALWPHQDFI 199 ****************99************99******************************** PP TIGR00658 191 kkakkiakenggkleltedpkkavkdadviytDvwvsmGe.eekkeerlkllkpyqvneellel 253 ++++++a e+g+++++tedpk+avk++d+i+tD+wvsmGe e+++er+++l pyqvn ++++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2909 200 DQCQAFAVESGARITITEDPKEAVKGVDFIHTDIWVSMGEpVEAWDERIEQLLPYQVNAQMMKA 263 ****************************************9999******************** PP TIGR00658 254 a.kpevkflhCLPavr...................GeevtdevlegeasivfdeaenRlhaqka 297 + +p vkf+hCLPa++ G evt+ev+e++a+i f++aenR+h++ka lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2909 264 SgNPRVKFMHCLPAFHnsetkvgkdiaarypnlanGVEVTEEVFESPANIAFEQAENRMHTIKA 327 99************************************************************** PP TIGR00658 298 vlkall 303 +l+ l lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2909 328 ILVSAL 333 *99766 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (336 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 26.55 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory