Align Carbamate kinase; EC 2.7.2.2 (characterized, see rationale)
to candidate Pf6N2E2_2910 Carbamate kinase (EC 2.7.2.2)
Query= uniprot:P13982 (310 letters) >lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2910 Carbamate kinase (EC 2.7.2.2) Length = 309 Score = 514 bits (1324), Expect = e-150 Identities = 256/310 (82%), Positives = 284/310 (91%), Gaps = 1/310 (0%) Query: 1 MRIVVALGGNALLRRGEPMTADNQRENVRIAAEQIAKVAPGNELVIAHGNGPQVGLLALQ 60 MRIVVALGGNALLRRGEPMTADNQR N+R A EQIAK+ PGN+LVIAHGNGPQVGLL+LQ Sbjct: 1 MRIVVALGGNALLRRGEPMTADNQRINIRTATEQIAKIHPGNQLVIAHGNGPQVGLLSLQ 60 Query: 61 GAAYDKVSPYPLDVLGAETEGMIGYMIEQEMGNLLPFEVPFATILTQVEVDGKDPAFQNP 120 AAY V+PYPLDVLGAETEGMIGY+IEQE+GNLL FEVPFAT+LTQVEVDG DPAFQ P Sbjct: 61 AAAYTSVTPYPLDVLGAETEGMIGYIIEQELGNLLDFEVPFATLLTQVEVDGNDPAFQKP 120 Query: 121 TKPIGPVYSREEAERLAAEKGWSIAPDGDKFRRVVPSPRPKRIFEIRPVKWLLEKGTIVI 180 TKPIGPVYS+EEA++LAAEKGW+IAPDGDKFRRVV SPRPKRIFEIRP+KWLLEKG+IVI Sbjct: 121 TKPIGPVYSQEEAQKLAAEKGWAIAPDGDKFRRVVASPRPKRIFEIRPIKWLLEKGSIVI 180 Query: 181 CAGGGGIPTMYDEAGKKLSGVEAVIDKDLCSSLLAQELVADILIIATDVDAAYVDWGKPT 240 CAGGGGIPTMYD G KL GVEAVIDKDLCS+LLA++L +D+L+IATDV+AA++D+GKPT Sbjct: 181 CAGGGGIPTMYDADG-KLQGVEAVIDKDLCSALLAEQLESDLLVIATDVNAAFIDFGKPT 239 Query: 241 QKAIAQAHPDELERLGFAAGSMGPKVQAAIEFARATGKDAVIGSLADIVAITEGKAGTRV 300 QKAIAQAHPDE+E+LGFAAGSMGPKVQAA EFAR TGK AVIGSL+DI AI GKAGTR+ Sbjct: 240 QKAIAQAHPDEMEKLGFAAGSMGPKVQAACEFARNTGKVAVIGSLSDIDAIVLGKAGTRI 299 Query: 301 STRKAGIEYR 310 ST GI YR Sbjct: 300 STATPGIAYR 309 Lambda K H 0.317 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 410 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 309 Length adjustment: 27 Effective length of query: 283 Effective length of database: 282 Effective search space: 79806 Effective search space used: 79806 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate Pf6N2E2_2910 (Carbamate kinase (EC 2.7.2.2))
to HMM TIGR00746 (arcC: carbamate kinase (EC 2.7.2.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00746.hmm # target sequence database: /tmp/gapView.20714.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00746 [M=309] Accession: TIGR00746 Description: arcC: carbamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.5e-133 427.9 0.1 1.1e-132 427.8 0.1 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2910 Carbamate kinase (EC 2.7.2.2) Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2910 Carbamate kinase (EC 2.7.2.2) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 427.8 0.1 1.1e-132 1.1e-132 1 308 [. 1 300 [. 1 301 [. 0.99 Alignments for each domain: == domain 1 score: 427.8 bits; conditional E-value: 1.1e-132 TIGR00746 1 kkvvvaLGGnallqrgekasaeeqrknvekaakqlvklakrgyelvithGngPqvGalllqnea 64 +++vvaLGGnall+rge ++a++qr n+++a++q++k++ g++lvi+hGngPqvG l lq +a lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2910 1 MRIVVALGGNALLRRGEPMTADNQRINIRTATEQIAKIHP-GNQLVIAHGNGPQVGLLSLQAAA 63 589*************************************.*********************** PP TIGR00746 65 adsvpakPldvlgaesqgliGYllqqalkeelakeglekkvatvltqvivdekDeaFqnPtkpi 128 + sv+++Pldvlgae++g+iGY+++q+l + l +e ++at+ltqv+vd +D+aFq+Ptkpi lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2910 64 YTSVTPYPLDVLGAETEGMIGYIIEQELGNLLD---FEVPFATLLTQVEVDGNDPAFQKPTKPI 124 ********************************9...**************************** PP TIGR00746 129 gpfydeeeakrlaaekgailkedagrgwRrvvpsPkPkeiveaeviktLvekgvivissgGGGv 192 gp+y++eea++laaekg+ ++ +g+++Rrvv+sP+Pk+i+e++ ik+L+ekg ivi++gGGG+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2910 125 GPVYSQEEAQKLAAEKGWAIAP-DGDKFRRVVASPRPKRIFEIRPIKWLLEKGSIVICAGGGGI 187 **********************.9**************************************** PP TIGR00746 193 Pvvkdgke.lkGveaviDkDlasekLaeevnaDilviltdvdavyvnygkpdekkleevkveel 255 P+++d ++ l+GveaviDkDl+s++Lae++++D lvi+tdv+a+++++gkp++k++++++++e+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2910 188 PTMYDADGkLQGVEAVIDKDLCSALLAEQLESDLLVIATDVNAAFIDFGKPTQKAIAQAHPDEM 251 ***997655******************************************************* PP TIGR00746 256 eelakdgefaaGsmgPkveaaiefvesrgkkaiitslekivealegkaGtvvv 308 e+l faaGsmgPkv+aa ef++++gk a+i+sl++i +++ gkaGt+++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2910 252 EKLG----FAAGSMGPKVQAACEFARNTGKVAVIGSLSDIDAIVLGKAGTRIS 300 ****....*******************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (309 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.23 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory