Align Arginine N-succinyltransferase; AST; AOST; EC 2.3.1.109 (characterized)
to candidate Pf6N2E2_2181 Arginine N-succinyltransferase (EC 2.3.1.109)
Query= SwissProt::Q8ZPV1 (344 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2181 Length = 344 Score = 310 bits (795), Expect = 3e-89 Identities = 159/335 (47%), Positives = 217/335 (64%), Gaps = 2/335 (0%) Query: 3 VIRPVEHADIAALMQLAGKTGGGLTSLPANEATLAARIERALKTWSGELPKGEQGYVFVL 62 ++RPV D+ AL+ LA G G TSLPANE LA RI A +T++G++ + + Y+FVL Sbjct: 2 IVRPVAITDLPALLDLARCAGPGFTSLPANEERLAHRIRWAQRTFAGQVERADADYLFVL 61 Query: 63 EDSETGEVGGICAIEVAVGLNDPWYNYRVGTLVHASKELNVYNALPTLFLSNDHTGSSEL 122 ED + +V GI A+ AVGL +PWYNYRVG V ++ EL + +PTLFL+N+ +G SE+ Sbjct: 62 EDDDR-QVVGISALTGAVGLREPWYNYRVGLTVSSAPELGIQRQIPTLFLNNEMSGQSEI 120 Query: 123 CTLFLDPEWRKEGNGYLLSKSRFMFMAAFRDKFNEKVVAEMRGVIDEHGYSPFWQSLGKR 182 C+LFL PE R+ NG LLS +R +F+A F F EK++AE+RG DE G SPFW SLG+ Sbjct: 121 CSLFLHPEQRRGHNGRLLSLARLLFVAEFSQLFGEKMIAELRGHADERGSSPFWDSLGRH 180 Query: 183 FFSMDFSRADFLCGTGQKAFIAELMPKHPIYTHFLSEEAQAVIGEVHPQTAPARAVLEKE 242 FF DFS AD L G G K+FIAELMP+ P+YT L+E+AQAVIG+ HP T PA +L E Sbjct: 181 FFKKDFSYADQLSGMGNKSFIAELMPRQPLYTCLLTEQAQAVIGKAHPNTEPALKILSAE 240 Query: 243 GFRYRHYIDIFDGGPTLECDIDRVRAIRKSRLVEVAEGQPAPGDYPACLVANENYHHFRA 302 GF ++ YIDIFDGGP +E + ++R +R S+++ + G P P P L+ N + R Sbjct: 241 GFSHKGYIDIFDGGPVIEAPVSKIRTVRDSQMLTLVIGTPDP-QAPVWLIHNRRLENCRV 299 Query: 303 ALVRADPQTSRLVLTAAQLDALKCRAGDHVRLVRL 337 RA +L++ L+ + GD VR V L Sbjct: 300 TSARAHLHGHKLLVDRLTAKRLQVQPGDTVRAVAL 334 Lambda K H 0.321 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 344 Length adjustment: 29 Effective length of query: 315 Effective length of database: 315 Effective search space: 99225 Effective search space used: 99225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate Pf6N2E2_2181 (Arginine N-succinyltransferase (EC 2.3.1.109))
to HMM TIGR03244 (astA: arginine N-succinyltransferase (EC 2.3.1.109))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03244.hmm # target sequence database: /tmp/gapView.2831.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03244 [M=336] Accession: TIGR03244 Description: arg_catab_AstA: arginine N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-138 446.2 0.0 3.3e-138 446.1 0.0 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2181 Arginine N-succinyltransferase ( Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2181 Arginine N-succinyltransferase (EC 2.3.1.109) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 446.1 0.0 3.3e-138 3.3e-138 1 336 [] 2 334 .. 2 334 .. 0.99 Alignments for each domain: == domain 1 score: 446.1 bits; conditional E-value: 3.3e-138 TIGR03244 1 ivrpvktsdldallelakeaGvGltslpaneellekrieraeksfageleraeegylfvledte 64 ivrpv +dl+all+la+ aG G+tslpanee+l++ri +a+++fag++era+++ylfvled + lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2181 2 IVRPVAITDLPALLDLARCAGPGFTSLPANEERLAHRIRWAQRTFAGQVERADADYLFVLED-D 64 79************************************************************.8 PP TIGR03244 65 tgkvvGvsaieaavGleepfynyrvgkvvhaskelniykkletlflsndltgaselCtlfldee 128 + +vvG+sa+ avGl+ep+ynyrvg +v+++ el+i ++++tlfl n++ g+se+C+lfl++e lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2181 65 DRQVVGISALTGAVGLREPWYNYRVGLTVSSAPELGIQRQIPTLFLNNEMSGQSEICSLFLHPE 128 999************************************************************* PP TIGR03244 129 yrkelnGkllskarflflaefkerfskkiiaemrGvsdeeGrsPfWealgkkffsldfskadyl 192 r+++nG+lls ar+lf+aef+++f++k+iae+rG++de G+sPfW++lg++ff+ dfs ad l lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2181 129 QRRGHNGRLLSLARLLFVAEFSQLFGEKMIAELRGHADERGSSPFWDSLGRHFFKKDFSYADQL 192 **************************************************************** PP TIGR03244 193 sgiGkkafiaelmPkfPiyvdllskeaqdvigkvhektkPalalleseGlryqgyvdifdaGpt 256 sg+G+k+fiaelmP+ P+y++ll+++aq+vigk h++t+Pal++l +eG+ ++gy+difd+Gp+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2181 193 SGMGNKSFIAELMPRQPLYTCLLTEQAQAVIGKAHPNTEPALKILSAEGFSHKGYIDIFDGGPV 256 **************************************************************** PP TIGR03244 257 leaevakiravresklvevavaesaaedeaepylvanekledfrvvlvessldaeelvlsaeea 320 +ea v+kir+vr+s+++++ ++++ ++ + l++n++le++rv+ ++++l+ ++l++++ +a lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2181 257 IEAPVSKIRTVRDSQMLTLVIGTPDPQA--PVWLIHNRRLENCRVTSARAHLHGHKLLVDRLTA 318 ***********************99988..99******************************** PP TIGR03244 321 kalkveeGdkvrvval 336 k+l+v+ Gd+vr val lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2181 319 KRLQVQPGDTVRAVAL 334 *************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (336 nodes) Target sequences: 1 (344 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.93 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory