Align 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 (characterized)
to candidate Pf6N2E2_1623 Siderophore biosynthesis diaminobutyrate--2-oxoglutarate aminotransferase (EC 2.6.1.76)
Query= SwissProt::P50457 (421 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1623 Length = 476 Score = 222 bits (565), Expect = 2e-62 Identities = 149/413 (36%), Positives = 223/413 (53%), Gaps = 22/413 (5%) Query: 27 QSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFT--HTAYQIVPYES 84 Q A ++D +G ++D AG L GH HP +AA+ Q L HT P + Sbjct: 55 QEAHGLYVRDTQGQLFMDCLAGAGTLALGHNHPVAIAAMRQTLDSGLPLHTLDLTTPVKD 114 Query: 85 YVTLAEKINALAP-VSGQAKTAFF-TTGAEAVENAVKIARAHTGRPGVIAFSGGFHGRTY 142 + + NAL + A+ F TGA+ +E A+K+AR TGR +++FSGG+HG T Sbjct: 115 RF-VEDLFNALPENFARHARIQFCGPTGADGIEAALKLARTATGRKPILSFSGGYHGMTL 173 Query: 143 MTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLH---GISTQDSLDA----IERLFKSDIE 195 T++L G + P K G V +PYP D GI + +DA IE+L SD E Sbjct: 174 GTLSLMGNLGP-KQALGSLMADVQFLPYPYDYRCPFGIGGEAGVDAGLHFIEQLL-SDPE 231 Query: 196 AKQV--AAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKLFAM 253 + + AA++ E VQGEGG AP + +R+L + G+ +I DEVQ+G RTGKLFA Sbjct: 232 SGVLPPAAVVVEVVQGEGGVIPAPIRWLQGLRQLTRKFGVALIIDEVQTGLGRTGKLFAF 291 Query: 254 DHYADKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNI 313 +H +PD++ ++K++ GG+PL+ +V +D PG GT+ GN +A+AA A L Sbjct: 292 EHADIEPDILVLSKAIGGGLPLAVMVYREE-LDTWKPGAHAGTFRGNQMAMAAGAATLRH 350 Query: 314 IDKESLCERANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEF-----NDPQTGEPSA 368 I E L A+ +GQRL L ++ + VRG G M+ VE +D + Sbjct: 351 IISEDLPGHADVMGQRLMAALRQLQDRYACLGQVRGRGLMVGVEIVSDTASDSRVPAADT 410 Query: 369 AIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALSD 421 A+AQ IQ++ L G++L G +G V+RFL PL I + D +++ Q AL++ Sbjct: 411 ALAQAIQRQCLRLGVILELGGRHGAVVRFLPPLIIQAEEVDVLVELFQVALAN 463 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 476 Length adjustment: 33 Effective length of query: 388 Effective length of database: 443 Effective search space: 171884 Effective search space used: 171884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory