Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate Pf6N2E2_5567 Glutamate Aspartate transport ATP-binding protein GltL (TC 3.A.1.3.4)
Query= TCDB::A3ZI83 (242 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5567 Length = 244 Score = 235 bits (599), Expect = 7e-67 Identities = 122/245 (49%), Positives = 172/245 (70%), Gaps = 4/245 (1%) Query: 1 MIELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVV 60 MI +KN+NK+YG VL N + V +GE +V+ GPSGSGKST I+C+N LE G++VV Sbjct: 1 MISIKNINKWYGDFQVLTNCSTEVSKGEVVVVCGPSGSGKSTLIKCVNALEPFQKGDIVV 60 Query: 61 NNL-VLNHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETAFKY 119 + + + K + R MVFQHF L+PH+T+ +NLT+A +K+ +SK+EA + + Sbjct: 61 DGTSIADPKTNLPKLRSRVGMVFQHFELFPHLTITENLTIAQIKVLGRSKEEATKKGLQL 120 Query: 120 LKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDVMK 179 L+ VGL A+ +P LSGGQQQRVAIAR+L +LFDEPTSALDPE + EVLDVM Sbjct: 121 LERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPVVMLFDEPTSALDPEMVNEVLDVMV 180 Query: 180 EISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFS--NPKTERARLFLG 237 +++H+ TM+ VTHEMGFA++VA+R+IFM+ G I+E+ EFF + ++ERA+ FL Sbjct: 181 QLAHE-GMTMMCVTHEMGFARKVANRVIFMDQGQIIEDCKKEEFFGDISARSERAQHFLE 239 Query: 238 KILKN 242 KIL++ Sbjct: 240 KILQH 244 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 244 Length adjustment: 23 Effective length of query: 219 Effective length of database: 221 Effective search space: 48399 Effective search space used: 48399 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory