Align Glutamate/aspartate import permease protein GltJ (characterized)
to candidate Pf6N2E2_2051 Amino acid ABC transporter, permease protein
Query= SwissProt::P0AER3 (246 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2051 Length = 220 Score = 103 bits (256), Expect = 4e-27 Identities = 65/216 (30%), Positives = 107/216 (49%), Gaps = 13/216 (6%) Query: 25 IWSGFQVTIALSICAWIIAFLVGSFFGILRTVPNRFLSGLGTLYVELFRNVPLIVQFFTW 84 +W+GF ++ S+ A ++ L+G G++ T ++ YV+L R P+ V Sbjct: 18 LWAGFLTSVQCSLLAIVLGTLIGLVAGLVLTYGRTWMRAPFRFYVDLIRGTPVFVLVLAC 77 Query: 85 YLVIPELLPEKIGMWFKAELDPNIQFFLSSMLCLGLFTAARVCEQVRAAIQSLPRGQKNA 144 + + P L W I F + +L L LF + V E VR A+Q+LPRGQ A Sbjct: 78 FYMAPAL------GW-------QIGAFQAGVLGLTLFCGSHVAEIVRGALQALPRGQMEA 124 Query: 145 ALAMGLTLPQAYRYVLLPNAYRVIVPPMTSEMMNLVKNSAIASTIGLVDMAAQAGKLLDY 204 + A+GLT Q+ YVLLP A R I+P + +VK S + S IG+ ++ +++ Sbjct: 125 SQAIGLTFYQSLGYVLLPQALRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQIIAR 184 Query: 205 SAHAWESFTAITLAYVLINAFIMLVMTLVERKVRLP 240 + E + + +IN I L+ +E++V LP Sbjct: 185 TFMTLEFYLFAGFLFFIINYAIELLGRHIEKRVALP 220 Lambda K H 0.328 0.140 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 246 Length of database: 220 Length adjustment: 23 Effective length of query: 223 Effective length of database: 197 Effective search space: 43931 Effective search space used: 43931 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory