Align glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized)
to candidate Pf6N2E2_5403 Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)
Query= CharProtDB::CH_011913 (426 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5403 Length = 375 Score = 300 bits (767), Expect = 6e-86 Identities = 181/405 (44%), Positives = 250/405 (61%), Gaps = 33/405 (8%) Query: 24 RSITIQIVVLLLFLAGLVWLLNNAYVNLEAKGKDFNFSFLWTRAGYDLAQTLIPYSNDDT 83 R+ Q+V ++ +A +L +N NL+ +G F FL AG+ +AQ LI Y+ D+ Sbjct: 2 RAWVFQVVTVVAVIALGWFLFDNTQTNLQHRGITSGFGFLERSAGFGIAQHLIDYTEADS 61 Query: 84 HFRALIEGLLNTLLVSVLGCILATILGTIIGVLRLSQNWLVARIMTVYVETFRNIPLLLW 143 + R + GLLNTLLV+ +G ILATILG IIGV RLSQNW+++++ TVYVE FRNIP LL Sbjct: 62 YARVFLIGLLNTLLVTFIGVILATILGFIIGVARLSQNWIISKLATVYVEVFRNIPPLLQ 121 Query: 144 ILLMGTILAETRPVPKDFRLTEAMKAAGEEPKASMWFFDSVAVTNRGTNLPAPAFDHSLG 203 IL + + P P+A+ F D+ V++RG N+PA Sbjct: 122 ILFWYFAVFLSMP----------------GPRAAHNFGDTFFVSSRGLNMPAAL------ 159 Query: 204 VVDLGWNLPVSLNALAILAVMSASFWGWRRFMARAKAVQEATGTRPTTWWPSL-LILFAP 262 V + W +S+ LAI+A++ + W +RF EATG +W L L L P Sbjct: 160 VAEGFWPFVISV-VLAIVAIVLMTRWANKRF--------EATGEPFHKFWVGLALFLVIP 210 Query: 263 -ISALLYGLGFHLDYPQITKFDFTGGFQMLHSFTALLIALTLYTAAFIAEIVRAGIQAIS 321 +SALL+G H + P++ F+F GG+ ++ AL +ALT+YTAAFIAEIVR+GI+++S Sbjct: 211 ALSALLFGAPVHWEMPELKGFNFVGGWVLIPELLALTLALTVYTAAFIAEIVRSGIKSVS 270 Query: 322 RGQTEAAYALGLRPGRTMSLVILPQALRVIVPPLISQFLNLTKNSSLAIAVSYMDLRGTL 381 GQTEAA +LGLR G T+ VI+PQALRVI+PPL SQ+LNL KNSSLA + Y ++ Sbjct: 271 HGQTEAARSLGLRNGPTLRKVIIPQALRVIIPPLTSQYLNLAKNSSLAAGIGYPEMVSLF 330 Query: 382 GGITLNQTGRELECMLLMMLIYLTISLTISSLMNLYNKSIKLKER 426 G LNQTG+ +E + + M +YL IS++IS LMN YNK I L ER Sbjct: 331 AGTVLNQTGQAIEVIAITMSVYLAISISISLLMNWYNKRIALIER 375 Lambda K H 0.326 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 375 Length adjustment: 31 Effective length of query: 395 Effective length of database: 344 Effective search space: 135880 Effective search space used: 135880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory