Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate Pf6N2E2_3921 Cystine ABC transporter, ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3921 Length = 253 Score = 216 bits (551), Expect = 3e-61 Identities = 115/247 (46%), Positives = 160/247 (64%), Gaps = 8/247 (3%) Query: 1 MIELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVV 60 MI ++ + K + VL I+L ++EGE + IIGPSGSGK+T +RC+N LEE SSG + V Sbjct: 1 MIVVEKLTKQFKGQVVLNGIDLKIEEGEVVAIIGPSGSGKTTFLRCLNFLEEPSSGRIKV 60 Query: 61 NNLVLN-------HKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAE 113 ++ ++ + + R+ VFQ+FNL+PH T L+N+T P ++K + EAE Sbjct: 61 GDIEIDGSRPLNQQQGLVRRLRQQVGFVFQNFNLFPHRTALENVTEGPQVVKKIPRTEAE 120 Query: 114 ETAFKYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQE 173 K L VGL K + YP LSGGQQQRVAIAR+L + ILFDEPTSALDPE + E Sbjct: 121 ALGRKLLAKVGLAGKEDAYPRRLSGGQQQRVAIARALAMEPAVILFDEPTSALDPELVGE 180 Query: 174 VLDVMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERAR 233 VL +++++ + TMV+VTHEMGFA++VA+R++F + G IVE+ F+ PK ER R Sbjct: 181 VLATIRDLAEEKR-TMVIVTHEMGFARDVANRVVFFDKGVIVEQGEAKALFAAPKEERTR 239 Query: 234 LFLGKIL 240 FL K L Sbjct: 240 QFLSKFL 246 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 253 Length adjustment: 24 Effective length of query: 218 Effective length of database: 229 Effective search space: 49922 Effective search space used: 49922 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory