Align ABC transporter for D-Cellobiose and D-Salicin, permease component 2 (characterized)
to candidate Pf6N2E2_2891 Glucose ABC transport system, inner membrane component 1
Query= reanno::Smeli:SMc04258 (302 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2891 Length = 297 Score = 247 bits (631), Expect = 2e-70 Identities = 123/286 (43%), Positives = 178/286 (62%) Query: 9 ARPNQWLRNLNAKIASIPMILTAMVIFVGGTAWTVVYSFTNSKLLPRLAFVGFDQYERLW 68 A P L+ K+ P + +V F G WT V SFT S LP + G QY RL Sbjct: 5 ASPFDALQRWLPKLVLAPSMFIVLVGFYGYILWTFVLSFTTSTFLPNYKWAGLAQYARLM 64 Query: 69 AAPRWLVSIQNLAVFGCLSLVFSLVIGFVLAALMDQKIRFENTFRTIMLYPFALSFIVTG 128 RW V+ +NLA+FG L + +LVIG +LA +DQ+IR E RTI LYP ALS IVTG Sbjct: 65 DNDRWWVASKNLALFGGLFIGITLVIGVLLAVFLDQRIRREGFIRTIYLYPMALSMIVTG 124 Query: 129 LVWQWLLNPQYGIQSIVRSLGWTSFSFDPLYNSNIVIYGILIAALWQGTGLVMCLMLAGL 188 W+WLLNP G+ ++R GW F D L + + V+Y ++IAA+WQ +G +M + LAGL Sbjct: 125 TAWKWLLNPGMGLDKLLRDWGWEGFRLDWLIDPDRVVYCLVIAAVWQASGFIMAMFLAGL 184 Query: 189 RGIDEDIWKAARVDGIPMWKTYVLIIIPMMRGVFITTLVIIASGIVKVYDLVVAQTSGGP 248 RG+D+ I +AA++DG M + Y +++P +R VF + ++I+A +K +DLV A T+GGP Sbjct: 185 RGVDQSIIRAAQIDGASMPRIYWKVVLPSLRPVFFSAVMILAHIAIKSFDLVAAMTAGGP 244 Query: 249 GIASEVPAKYVYDYMFQAQNLGQGFAASTMMLVTVAIIIVPWAYLE 294 G +S++PA ++Y + F +G G A++ +ML + IIVP+ Y E Sbjct: 245 GYSSDLPAMFMYSFTFSRGQMGMGSASAILMLGAILAIIVPYLYSE 290 Lambda K H 0.329 0.142 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 297 Length adjustment: 27 Effective length of query: 275 Effective length of database: 270 Effective search space: 74250 Effective search space used: 74250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory