Align ABC transporter for D-Cellobiose and D-Salicin, periplasmic substrate-binding protein (characterized)
to candidate Pf6N2E2_2892 Glucose ABC transport system, periplasmic sugar-binding protein
Query= reanno::Smeli:SMc04259 (411 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_2892 Length = 399 Score = 213 bits (543), Expect = 6e-60 Identities = 123/342 (35%), Positives = 178/342 (52%), Gaps = 11/342 (3%) Query: 26 LEVTHWWTSGGEAAAVAELAKAFDATGNKWVDGAIAGSGG-TARPIMISRITGGDPMAAT 84 +EV HWWTSGGE AA+ L + G W DGA+AG GG TA ++ SR G+P Sbjct: 1 VEVVHWWTSGGEKAAIDVLKAQVEKDGFTWKDGAVAGGGGSTAMTVLKSRAVAGNPPGVA 60 Query: 85 QFNHGRQAEELVQAGLMRD--LTDIATKENWKEIVKPSSLLDSCTIEGKIYCAPVNIHSW 142 Q G +E GL+ L D+A +E W ++ + D+ +G PVNIH Sbjct: 61 QIK-GPDIQEWATTGLLDTDVLKDVAKQEKWDGLLD-KKVSDTVKYDGDYVAVPVNIHRV 118 Query: 143 QWLWLSNAAFKQAGV-EVPKNWDEFVAAAPALEKAGIVPLAVGGQPWQANGAFDVLMVAI 201 WLW++ FK+AG+ + P +EF AA L+ AG +PLA GGQPWQ + F+ +++++ Sbjct: 119 NWLWINPEVFKKAGITKNPTTLEEFYAAGDKLKAAGFIPLAHGGQPWQDSTVFEAVVLSV 178 Query: 202 AGKENFEKVFAQKDEEVAAGPEIAKVFKAADD-ARRMSKGTNVQDWNQATNMVITGKAGG 260 G + ++K D + GPE+ K A M QDWN VI GKAG Sbjct: 179 MGADGYKKALVDLDNKALTGPEMVKALTELKKVATYMDDDGKGQDWNLEAAKVINGKAGM 238 Query: 261 QIMGDWAQGEFQLAGQKAGVDYTCLPGLGVNEVISTGGDAFYFPLLEDEEKSKAQEVLAS 320 QIMGDWA+ E+ A + AG DY C+ G ++ + D+ +D+ + Q+ +A Sbjct: 239 QIMGDWAKSEWTAAKKVAGKDYECVAFPGTDKAFTYNIDSLAVFKQKDKGTAAGQQDIAK 298 Query: 321 TLLKPETQVAFNLKKGSLPVRGDVDLAAANDCMKKGLDILAK 362 +L Q F++ KGS+PVR D+ D K G D A+ Sbjct: 299 VVLGENFQKVFSINKGSIPVRNDM----LGDMAKYGFDSCAQ 336 Lambda K H 0.315 0.131 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 500 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 411 Length of database: 399 Length adjustment: 31 Effective length of query: 380 Effective length of database: 368 Effective search space: 139840 Effective search space used: 139840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory