Align glucose 1-dehydrogenase (PQQ, quinone) (EC 1.1.5.2) (characterized)
to candidate Pf6N2E2_1895 PQQ-dependent oxidoreductase, gdhB family
Query= BRENDA::I7A144 (352 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1895 Length = 372 Score = 167 bits (422), Expect = 5e-46 Identities = 124/348 (35%), Positives = 173/348 (49%), Gaps = 39/348 (11%) Query: 21 LRVEEVVGGLEVPWALAFLPDGGMLIAERPGRIRLF-REGRLSTYAE-LP-VYHRGESGL 77 +R E V GLE PWA+AFLP L+ ERPGR+R+ +G + E LP + G+ GL Sbjct: 27 VRAERVATGLENPWAVAFLPAHRYLVTERPGRLRVVGADGSIGPPVEGLPAIAAGGQGGL 86 Query: 78 LGLALHPRFPEAPYVY-AYRTVAEGGLRNQ--VVRLRHLGERGVLD--RVVLDGIPARPH 132 L + F VY + A GG N V R LD +V+ P Sbjct: 87 LDVVTDSAFDVNRMVYFCFSEPAAGGAGNSTAVARATLSSNMVRLDNLQVIFSQRPKVSS 146 Query: 133 GLHSGGRIAFGPDGMLYVTTGEVYER-ELAQDLASLGGKILRLTPEGEPAPGNPFLGRRG 191 H G RI DG L+VT GE Y R E AQ+L + GK++R+ +G NPF+GR G Sbjct: 147 SAHFGCRIVEAKDGTLFVTLGERYSRKEDAQELDNHLGKVVRIQKDGVVPTDNPFVGRPG 206 Query: 192 ARPEVYSLGHRNPQGLAWHPKTGELFSSEHGPSGEQGYGHDEVNLIVPGGNYGWPRV--- 248 A PE++S GHRN QG P G L+ ++HGP G DE+N+ + G NYGWP + Sbjct: 207 ALPEIWSYGHRNSQGATLGP-DGRLWMNDHGPQ-----GGDEINVPLAGRNYGWPVITYG 260 Query: 249 -------VGRGNDPR--YRDPLYFWPQGFPPGNLAF---------FRGDLYVAGLRGQAL 290 +G G + PL++W P +AF ++G+L+V L+ L Sbjct: 261 ENYGGGKIGDGLTAKDGMEQPLHYWVPSIAPSGMAFLTSDRYGPAWKGNLFVGSLKFGYL 320 Query: 291 LRLVLEGERGRWRVLRVETALSGFGRLREVQVGPDGALYVTTSNRDGR 338 R+ L+ + V + G R+R+V+ GPDG LYV T +DG+ Sbjct: 321 DRIELKDGK---VVAEHKLLEDGHARVRDVRQGPDGLLYVLTDEQDGK 365 Lambda K H 0.322 0.146 0.460 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 519 Number of extensions: 37 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 372 Length adjustment: 29 Effective length of query: 323 Effective length of database: 343 Effective search space: 110789 Effective search space used: 110789 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory