Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate Pf6N2E2_1634 ABC-type Fe3+-siderophore transport system, permease component
Query= CharProtDB::CH_004160 (318 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1634 Length = 321 Score = 202 bits (514), Expect = 9e-57 Identities = 121/315 (38%), Positives = 185/315 (58%), Gaps = 10/315 (3%) Query: 9 ITLALAGCALLSLHMGVIPVPWRALLTDWQA------GHEHYYVLMEYRLPRLLLALFVG 62 + +A+A +LL L +G +PW+ WQA G+ V+ RLPRLL+A+ VG Sbjct: 7 LLMAIALTSLLHLAVGAKDIPWQEA---WQALVAYAPGNPDQSVIRGSRLPRLLVAMLVG 63 Query: 63 AALAVAGVLIQGIVRNPLASPDILGVNHAASLASVGALLLMPSLPVMVLPLLAFAGGMAG 122 A+L +AG ++Q + NPLA P ILG+N A+L V LL++P + ++PL AFAG + Sbjct: 64 ASLGLAGAIMQAVGDNPLADPGILGINSGAALFVVFGLLVLPGNDMSMIPLFAFAGALVA 123 Query: 123 LILLKMLA-KTHQPMKLALTGVALSACWASLTDYLMLSRPQDVNNALLWLTGSLWGRDWS 181 + + +LA + H P++L L+G ++A ++++T L+L Q +++ WLTGS+ S Sbjct: 124 SVGVLLLAGRGHNPIRLTLSGAMIAALFSAITSILLLLDQQGLDSLRRWLTGSIGVTGGS 183 Query: 182 FVKIAIPLMILFLPLSLSFCRDLDLLALGDARATTLGVSVPHTRFWALLLAVAMTSTGVA 241 P ++L + L L R L+ LG A +GV++ R L V ++ VA Sbjct: 184 MQAWVWPYVLLGMCLCLVNVRALNAHRLGPQAAAGMGVNLLKMRVLGLASVVLLSGGAVA 243 Query: 242 ACGPISFIGLVVPHMMRSITGGRHRRLLPVSALTGALLLVVADLLARIIHPPLELPVGVL 301 GPI F+GLVVPH R + G +RRLL + L GALLL++AD+ AR + P EL G++ Sbjct: 244 LAGPIGFVGLVVPHAARLLFGDDYRRLLLAAPLLGALLLILADIAARTVVRPFELNTGIV 303 Query: 302 TAIIGAPWFVWLLVR 316 TA+IG P FV L++R Sbjct: 304 TALIGGPIFVVLVLR 318 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 321 Length adjustment: 28 Effective length of query: 290 Effective length of database: 293 Effective search space: 84970 Effective search space used: 84970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory