Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate Pf6N2E2_3544 ABC transporter (iron.B12.siderophore.hemin) , ATP-binding component
Query= CharProtDB::CH_088321 (255 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3544 Length = 262 Score = 164 bits (414), Expect = 2e-45 Identities = 92/233 (39%), Positives = 137/233 (58%), Gaps = 3/233 (1%) Query: 18 LNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLGDNPINMLSSRQLARR 77 L DV+L + G+ LIGPNG GK++LL C R P G V L + + SSR A+R Sbjct: 25 LRDVTLQVAAGEFVGLIGPNGSGKTSLLRCAYRFSRPAQGEVKLAHHNVWQQSSRWSAQR 84 Query: 78 LSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVAMNQTRINHLAVRRLT 137 ++++ Q G+TV+E+V+ GR P L+ + +D V A+ + Sbjct: 85 IAVVLQEFPDAFGLTVEEVVAMGRTPHKGLFDGDNHDDRRLVLQALESAGLAGFGDHAFA 144 Query: 138 ELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMGELRTQGKTVVAVLHD 197 LSGG++QR LA LAQ +++LDEPT +LD ++Q+ L++L+ L G +A LHD Sbjct: 145 TLSGGEKQRVILARALAQQPQLLILDEPTNHLDPHYQLQLLQLIKGL---GIGTLASLHD 201 Query: 198 LNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAEIHPEPVSGRP 250 LN A+ +CD+L V+ +G ++A GTP EV+T LLR VF +EA + P+SG P Sbjct: 202 LNLAAAFCDRLYVIEHGRIVASGTPREVLTVELLREVFGIEALVDEHPLSGYP 254 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 262 Length adjustment: 24 Effective length of query: 231 Effective length of database: 238 Effective search space: 54978 Effective search space used: 54978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory