Align ABC transporter for L-Arginine and L-Citrulline, permease component 2 (characterized)
to candidate Pf6N2E2_3920 Cystine ABC transporter, permease protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3433 (232 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3920 Length = 221 Score = 122 bits (305), Expect = 7e-33 Identities = 71/213 (33%), Positives = 115/213 (53%), Gaps = 9/213 (4%) Query: 10 EALPLYLGGLVTTLKLLALSLFFGLLAALPLGLMRVSKQPVVNMSAWLFTYVIRGTPMLV 69 ++ P L G T+ L +FFGLL L LMR+S+ +VN A ++ RGTP+LV Sbjct: 10 DSAPFLLKGAYYTVFLSLGGMFFGLLLGFGLALMRLSRFKLVNWIARIYVSFFRGTPLLV 69 Query: 70 QLFLIYYGLAQFEAVRESFLWPWLSSATFCACLAFAINTSAYTAEIIAGSLRATPNGEIE 129 QLF+IYYGL Q + A + F++N +AY EI+ ++ + G+ E Sbjct: 70 QLFVIYYGLPQLGIELDPLP---------AALIGFSLNMAAYACEILRAAISSIERGQWE 120 Query: 130 AAKAMGMSRIKMYKRILLPSALRRALPQYSNEVIMMLQTTSLASIVTLIDITGAARTVNA 189 AA ++GM+R + +R +LP A R ALP N I +++ T+LA+ + + ++ A+ + A Sbjct: 121 AAASIGMTRAQTLRRAILPQAARTALPPLGNSFISLVKDTALAATIQVPELFRQAQLITA 180 Query: 190 QFYLPFEAYITAGVFYLCLTFILVRLFKMAEHR 222 + + F Y+ A + Y L +L L + E R Sbjct: 181 RTFEIFTMYLAAALIYWVLATVLSHLQNVLEAR 213 Lambda K H 0.330 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 109 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 221 Length adjustment: 22 Effective length of query: 210 Effective length of database: 199 Effective search space: 41790 Effective search space used: 41790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory