Align ABC transporter permease subunit; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine transport system permease protein (characterized, see rationale)
to candidate Pf6N2E2_1799 ABC transporter permease protein
Query= uniprot:A0A1N7UBU2 (233 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1799 Length = 292 Score = 120 bits (302), Expect = 2e-32 Identities = 77/214 (35%), Positives = 117/214 (54%), Gaps = 4/214 (1%) Query: 17 GAWMTLKLAFLALALSLALGLIAAAAKLSSAKWLRVPATLYTTLIRSVPDLVLILLIFYS 76 G T+ +A LA+AL + G+I A ++S+ LR A +YT L R P L+L LL++++ Sbjct: 75 GLLNTVVMAVLAMALGIVFGVITAIMRMSANPILRYVALIYTWLFRGTP-LILQLLLWFN 133 Query: 77 LQLWLNDLS--EVFGWDYFEI-DPFTAGVITLGFIYGAYFTENFRGAILSVPVGQLEAAT 133 L L + +F D + PF A ++ L GAY E R +LSV GQ EAA Sbjct: 134 LALIFPTIGIPGLFEMDTVSLMTPFVAALLGLSINQGAYTAEVVRAGLLSVDTGQYEAAK 193 Query: 134 AYGLSRWQRFHLVLFPQLMRFALPGLGNNWLVLLKSTALVSIIGLSDLVKAAQNAGKTTN 193 + G+ R Q ++ PQ MR +P +GN ++ ++K T+L S+I S+L+ AQN Sbjct: 194 SIGMPRLQALRRIILPQAMRIIIPPVGNEFIGMVKMTSLASVIQYSELLYNAQNIYYANA 253 Query: 194 EPLYFLILAGLMYLVITTLSNRVLKRLERRYNLG 227 + LI+AG+ YL T+ + RLERR+ G Sbjct: 254 RVMELLIVAGIWYLATVTVLSFGQSRLERRFARG 287 Lambda K H 0.327 0.141 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 292 Length adjustment: 25 Effective length of query: 208 Effective length of database: 267 Effective search space: 55536 Effective search space used: 55536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory