Align RnsD, component of The (deoxy)ribonucleoside permease; probably takes up all deoxy- and ribonucleosides (cytidine, uridine, adenosine and toxic analogues, fluorocytidine and fluorouridine tested), but not ribose or nucleobases (characterized)
to candidate Pf6N2E2_3469 Nucleoside ABC transporter, permease protein 2
Query= TCDB::Q8DU39 (318 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3469 Length = 308 Score = 151 bits (382), Expect = 2e-41 Identities = 96/301 (31%), Positives = 154/301 (51%), Gaps = 14/301 (4%) Query: 5 NMLALLISSMLVYATPLIFTSIGGVFSERSGVVNVGLEGIMVMGAFAGVVFNIEFAHSFG 64 ++L+ + +M+ TPL+ ++G + E+SGV+N+G EG+M+ GA G F +F Sbjct: 4 DLLSNIFYAMVRCGTPLLLVALGELVCEKSGVLNLGQEGMMLFGAVIG------FIVAFN 57 Query: 65 KATPWIAALVGGLVGLLFSLLHALATINFRADHIVSGTVLNLLAPSLAVFFVKALYNKGQ 124 W+ L+ G+L S L AL + F A+ + +G L + L+ F A K Sbjct: 58 SGNLWLGVLLAMAAGMLLSALFALVALVFNANQVATGLALTIFGVGLSSFVGAAWVGKPL 117 Query: 125 TDNISQSFGKFDFPILSHIPFLGPIFFQGTSLVAYLAVLFSVFAWFILTKTKFGLRLRSV 184 F P LS IP +G + F LV LF++ AW I+ K++ GL +++V Sbjct: 118 A-----GFEPLAIPYLSDIPLIGRMLFAQDLLVYLSFALFALVAWMIV-KSRVGLIIQAV 171 Query: 185 GEHPQAADTLGINVYLMRYLGVMISGLLGGIGGAIYAQSISVNFAGTTILGPGFIALAAM 244 GE+P AA +G+ V +R L V+ G + G+ GA + + + +A G G+IALA + Sbjct: 172 GENPDAASAMGLPVLRVRTLAVLFGGAMAGLAGAYLSLAYTPMWAENMSAGRGWIALALV 231 Query: 245 IFGKWNPIGAMLSSLFFGLSQSLAVIGGQLPFLSKIPTVYLQIAPYALTILVLAVFFGQA 304 +F W +L + FGL+ L ++ L IP+ L + PYA TI+VL + A Sbjct: 232 VFASWRVWRLLLGAYLFGLASILHLVAQGLGL--AIPSSLLAMLPYAATIVVLVLLSRDA 289 Query: 305 V 305 V Sbjct: 290 V 290 Lambda K H 0.328 0.143 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 308 Length adjustment: 27 Effective length of query: 291 Effective length of database: 281 Effective search space: 81771 Effective search space used: 81771 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory