Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate Pf6N2E2_1322 MoaE protein
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1322 Length = 266 Score = 119 bits (297), Expect = 9e-32 Identities = 85/250 (34%), Positives = 125/250 (50%), Gaps = 16/250 (6%) Query: 15 VLISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRARTAHPQLH---AGVADVSDCA- 70 V+I+GA GIGAA A+ + GAN+ + I R R L G+ V D A Sbjct: 7 VVITGAGTGIGAACARLYAAEGANLVL-------IGRRREPLEALAEDIGGLVLVGDAAC 59 Query: 71 --QVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRKA 128 D ++ R + G LD+L+ AG G G+ + P+ WE + +NL+S FY R Sbjct: 60 PNTWDGFVEQIRKRHGRLDVLLACAGGMG-MGSATETHPSAWEAALRSNLDSAFYSARAC 118 Query: 129 VPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAIL 188 +PLLKE++ N I+ +AS+A Y +K A++G+ +SLA + GP+ VRVNAI Sbjct: 119 LPLLKESAGN--IVLIASIASLAAGPHVCGYTTAKHALLGLNRSLARDYGPHGVRVNAIC 176 Query: 189 PGVVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPAGQN 248 PG V D + A + G Q + LRR + ++A + FLASP Sbjct: 177 PGWVRTPMADEEMQALMQFHGETLQQAYDRVCADVPLRRPASAEEIANVCRFLASPDASI 236 Query: 249 ISGQAISVDG 258 I+G + DG Sbjct: 237 ITGATLVADG 246 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 266 Length adjustment: 25 Effective length of query: 238 Effective length of database: 241 Effective search space: 57358 Effective search space used: 57358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory