Align alcohol dehydrogenase (cytochrome c) (EC 1.1.2.8) (characterized)
to candidate Pf6N2E2_4408 2-Keto-D-gluconate dehydrogenase (EC 1.1.99.4), membrane-bound, cytochrome c
Query= BRENDA::D2SZY5 (472 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_4408 Length = 474 Score = 254 bits (648), Expect = 6e-72 Identities = 162/436 (37%), Positives = 232/436 (53%), Gaps = 29/436 (6%) Query: 3 INRLKAALGAVAVGLLAGT-SLA-HAQNADEDLIKKGEYVARLGDCVACHTSLNGQKYAG 60 + ++K+ +A GL T SLA H + D G+ +A DCVACH+++ G+ +AG Sbjct: 13 VGKVKSMRNMLAGGLALMTISLATHGETLDTSA-SPGKRLAVAADCVACHSTVGGKPFAG 71 Query: 61 GLSIKTPIGTIYSTNITPDPTYGIGTYTFKEFDEAVRHGVRKDGATLYPAMPYPSFARMT 120 G + +P+GTIYSTNITP + GIG YT +F AVR GV DG LYPAMPY S+A+MT Sbjct: 72 GYPLNSPMGTIYSTNITPSRSAGIGQYTQADFARAVRDGVTPDGTHLYPAMPYTSYAKMT 131 Query: 121 QDDMKALYAYFMHGVQPIAQKNHPTDISWPMSMRWPLSIWRSVFAPAPKDFTPAPGTDAE 180 D+ ALY YFM V+P+ + T++ +P ++R + W ++F K F PG A+ Sbjct: 132 DSDVAALYQYFMDEVEPVDTPSPKTELDFPFNIRASMLGWNALF-HRQKRFEADPGKSAQ 190 Query: 181 IARGEYLVTGPGHCGACHTPRGFGMQEKALDASGGPDFLGGGGVIDNWIAPSLRNDPVLG 240 + RG+YLV HC CHTPR L A+ L GG + W AP++ +D G Sbjct: 191 VNRGDYLVNALAHCDTCHTPR------NVLMAADNAKALSGGS-LGAWYAPNITSDKTSG 243 Query: 241 LGRWSDEDLFLFLKSGRTDHSA-AFGGMADVVGWSTQYYTDADLHAMVKYIKSLPPVP-- 297 +G WS ++L +L+SG + A A G MA+ V S QY + DL A+ Y+ P+ Sbjct: 244 IGAWSSDELVAYLRSGHVEGKAQAAGPMAEAVEHSLQYLGEEDLKAIAAYLLQTQPIATG 303 Query: 298 --PARGDYSYDASTAQMLDSNNFSGNAGAKTYVEQCAICHRNDGGGVARMFPPLAGNPVV 355 AR + ++ L N G + CA CH+ +G G R +P L N Sbjct: 304 ERQARHTFGQASNDELNLRGGKPQDNPGWHIFSGTCANCHQANGEG-TREYPSLFHN-TA 361 Query: 356 VSDNPTSVAHIV------VDGGVLPPTNWAPSAVAMPDYKNILSDQQIADVVNFIRSAWG 409 S +A IV VDG + + P A+ + + L DQQIADV N++ S +G Sbjct: 362 TSRRDNLIATIVYGVHREVDGVAIDMPAFGPGAL----FTDRLDDQQIADVSNYVLSRYG 417 Query: 410 NRAPANTTAADIQKLR 425 N A N TAAD+ ++R Sbjct: 418 N-AGLNVTAADVAQVR 432 Lambda K H 0.318 0.135 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 656 Number of extensions: 38 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 474 Length adjustment: 33 Effective length of query: 439 Effective length of database: 441 Effective search space: 193599 Effective search space used: 193599 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory