Align 1-phosphofructokinase; Fructose 1-phosphate kinase; EC 2.7.1.56 (characterized)
to candidate Pf6N2E2_165 Ribokinase (EC 2.7.1.15)
Query= SwissProt::D4GYE6 (305 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_165 Length = 304 Score = 85.9 bits (211), Expect = 1e-21 Identities = 84/272 (30%), Positives = 118/272 (43%), Gaps = 29/272 (10%) Query: 37 GGKGINVAKYASALDADVTASGFLGGH-FGKFVRDRLDADGIASDFVTVDA--------- 86 GGKG N A A+ L A+V+ G +G +G+ +R L A+GI V+V Sbjct: 39 GGKGANQAVAAARLGAEVSMVGCVGNDAYGEQLRGGLLAEGIDCQAVSVVEGASGVALIV 98 Query: 87 --DTRLNTTVLAADGEYKLNHNGPQIRAADVDELVETAQANEPDTLLVGGSLPPGMSLSD 144 D N V+ A L VDE++++A D ++ +P Sbjct: 99 VDDNSQNAIVIVAGANGALTAEVLD----SVDEVLQSA-----DVIICQLEVPDATVGHA 149 Query: 145 VDRLARAGDWKIAVDMGGEYLAELDADYYVC----KPNRSELAAATGRTVETEADAVEAA 200 + R G KI + L AD+Y C PN SE A +G V++ A AA Sbjct: 150 LKRARELG--KIVILNPAPASHTLPADWYACIDYLVPNESEAAVLSGLAVDSLETAEAAA 207 Query: 201 EELHARGFEYVLASLGADGALLVTDDEVLSAPALDVEVVDTVGAGDAVMSGFLAAREHGL 260 L A G V+ +LGA G + PA V+ VDT AGD + GF AA G Sbjct: 208 AHLIAAGAGKVIVTLGAQGLMFANGVSFEHFPAPRVKAVDTTAAGDTFVGGFAAALASGK 267 Query: 261 SDADALRMGVLTASRVVGVAGTR--VPDLEDV 290 S+ DA+R G A+ V AG + +P L +V Sbjct: 268 SEVDAIRFGQAAAALSVTRAGAQPSIPTLLEV 299 Lambda K H 0.315 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 304 Length adjustment: 27 Effective length of query: 278 Effective length of database: 277 Effective search space: 77006 Effective search space used: 77006 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory