Align 1-phosphofructokinase (EC 2.7.1.56) (characterized)
to candidate Pf6N2E2_3338 1-phosphofructokinase (EC 2.7.1.56)
Query= reanno::pseudo5_N2C3_1:AO356_07330 (313 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3338 Length = 313 Score = 590 bits (1520), Expect = e-173 Identities = 303/313 (96%), Positives = 306/313 (97%) Query: 1 MAKILTLTLNPALDLTVELARLEPGQVNRSDAMHAHAAGKGVNVAQVLADLGHTLTVSGF 60 MAKILTLTLNPALDLTVEL RLEPGQVNRSD MHAHAAGKGVNVAQVLADLGHTLTVSGF Sbjct: 1 MAKILTLTLNPALDLTVELTRLEPGQVNRSDGMHAHAAGKGVNVAQVLADLGHTLTVSGF 60 Query: 61 LGEDNAQVFETLFAQRGFVDAFIRVPGETRSNIKLAEQDGRITDLNGPGPMVDAAAQQAL 120 LGEDNAQVFETLFAQRGFVDAFIRVPGETRSNIKLAEQDGRITDLNGPGP+VD AAQQAL Sbjct: 61 LGEDNAQVFETLFAQRGFVDAFIRVPGETRSNIKLAEQDGRITDLNGPGPVVDEAAQQAL 120 Query: 121 LARLEQIAPGHDVVVVAGSLPRGVSPQWLQALIARMKALGLNVALDTSGEALRVALAAGP 180 LARLEQIAPGHDVVVVAGSLPRGVSPQWLQALI R+K LGLNVALDTSGEALRVALAAGP Sbjct: 121 LARLEQIAPGHDVVVVAGSLPRGVSPQWLQALITRLKTLGLNVALDTSGEALRVALAAGP 180 Query: 181 WLIKPNTEELADALGCEVVSETAQAQAAQRLHAQGIEHVVISHGADGVNWFSVGAALHAS 240 WLIKPNTEELADALGCEVVSE AQAQAAQ LHAQG+EHVVISHGADGVNWFSVGAALHAS Sbjct: 181 WLIKPNTEELADALGCEVVSEAAQAQAAQHLHAQGVEHVVISHGADGVNWFSVGAALHAS 240 Query: 241 PPKVSVASTVGAGDSLLAGMLHGLLSADTPEQTLRTATAIAAMAVTQIGFGIHDTALLAS 300 PPKVSVASTVGAGDSLLAGMLHGLLSADTPEQTLRTATAIAAMAVTQIGFGIHDTALLAS Sbjct: 241 PPKVSVASTVGAGDSLLAGMLHGLLSADTPEQTLRTATAIAAMAVTQIGFGIHDTALLAS 300 Query: 301 LEQGVRVRPLTEQ 313 LEQGVRVRPLTEQ Sbjct: 301 LEQGVRVRPLTEQ 313 Lambda K H 0.317 0.132 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 486 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 313 Length adjustment: 27 Effective length of query: 286 Effective length of database: 286 Effective search space: 81796 Effective search space used: 81796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate Pf6N2E2_3338 (1-phosphofructokinase (EC 2.7.1.56))
to HMM TIGR03828 (pfkB: 1-phosphofructokinase (EC 2.7.1.56))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03828.hmm # target sequence database: /tmp/gapView.32189.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03828 [M=305] Accession: TIGR03828 Description: pfkB: 1-phosphofructokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-108 348.6 1.5 1.5e-108 348.4 1.5 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3338 1-phosphofructokinase (EC 2.7.1. Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3338 1-phosphofructokinase (EC 2.7.1.56) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 348.4 1.5 1.5e-108 1.5e-108 1 304 [. 4 307 .. 4 308 .. 0.99 Alignments for each domain: == domain 1 score: 348.4 bits; conditional E-value: 1.5e-108 TIGR03828 1 IlTvTlNpaiDktieleelelgevnrveserldagGKGinVarvLkklgvevvalgflGgftge 64 IlT+TlNpa+D+t+el +le+g+vnr ++ +a+GKG+nVa+vL++lg++ +++gflG+++++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3338 4 ILTLTLNPALDLTVELTRLEPGQVNRSDGMHAHAAGKGVNVAQVLADLGHTLTVSGFLGEDNAQ 67 89************************************************************** PP TIGR03828 65 eiealleeegiktdfvevkgetRinvkikessgeetklnepGpeiseeeleallekleeqlkeg 128 +e+l++++g+ ++f++v+getR+n+k++e++g+ t+ln+pGp ++e++++all++le+ ++ + lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3338 68 VFETLFAQRGFVDAFIRVPGETRSNIKLAEQDGRITDLNGPGPVVDEAAQQALLARLEQIAPGH 131 **********************************************************999*** PP TIGR03828 129 dvlvlaGSlPrgvpedlyaelikllrekgakvilDtsgeaLlkvlkakplliKPNkeEleellg 192 dv+v+aGSlPrgv++++++ li +l+ g++v+lDtsgeaL+ +l+a p+liKPN+eEl+++lg lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3338 132 DVVVVAGSLPRGVSPQWLQALITRLKTLGLNVALDTSGEALRVALAAGPWLIKPNTEELADALG 195 **************************************************************** PP TIGR03828 193 relkteeevieaarkllekgvenvlislGadGallvtkegalfakapkievkstvGAGDsmvAg 256 e+ +e++ +aa++l+++gve+v+is GadG+ +++ +al+a++pk++v+stvGAGDs++Ag lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3338 196 CEVVSEAAQAQAAQHLHAQGVEHVVISHGADGVNWFSVGAALHASPPKVSVASTVGAGDSLLAG 259 **************************************************************** PP TIGR03828 257 fllalekglsleealrlavAvgaaaassegtelpdledieelleevki 304 +l++l + ++e++lr+a+A++a a+++ g+++ d + +++l++ v++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3338 260 MLHGLLSADTPEQTLRTATAIAAMAVTQIGFGIHDTALLASLEQGVRV 307 *********************************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (305 nodes) Target sequences: 1 (313 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 7.70 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory