Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate Pf6N2E2_1960 Various polyols ABC transporter, ATP-binding component
Query= reanno::Smeli:SM_b21106 (365 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1960 Length = 365 Score = 334 bits (856), Expect = 3e-96 Identities = 179/372 (48%), Positives = 250/372 (67%), Gaps = 22/372 (5%) Query: 1 MAPVTLKKLVKRYGALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAI 60 MA + ++ L K + L ++ GIDLEVKD+EF+ VGPSGCGKST LR+IAGLE+V+ G I Sbjct: 1 MATLKIENLKKGFEGLSIIKGIDLEVKDKEFVVFVGPSGCGKSTLLRLIAGLEDVTSGTI 60 Query: 61 EIGGRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAI 120 E+ GR + ++ P R+++MVFQ+YALYPHMTV +N+ F+L +AG +++ +VAEAA I Sbjct: 61 ELDGRDITEVTPAKRDLAMVFQTYALYPHMTVRKNLSFALDLAGEKKPDVERKVAEAARI 120 Query: 121 LDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLH 180 L+L LL+R+P QLSGGQRQRVA+GRAIVR P +FLFDEPLSNLDA LR Q R E+ +LH Sbjct: 121 LELGSLLDRKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQTRLELSRLH 180 Query: 181 ARMQATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSPPMN 240 +QATMIYVTHDQVEAMTL+ ++V++ G IEQ+G+P +++ PA FVAGF+G+P M Sbjct: 181 KELQATMIYVTHDQVEAMTLATKVVVLNAGRIEQIGSPLELYHHPANLFVAGFLGTPKMG 240 Query: 241 MEEAVL-----TDGKLAFASGATLPLPPRFRSLVREGQKVTFGLRPDDVYPSGHGLHAGD 295 +A + + ++ FASG TL L PR S + GQ VT G+RP+ + S G Sbjct: 241 FLQATVHAVHASGVEVRFASGTTL-LIPRDSSALSVGQSVTIGIRPEHLTLSAEG----- 294 Query: 296 ADAVHEIELPVT--ITEPLGNETLVFTQF-NGRDWVSRMLNPRPLRPGEAVPMSFDLARA 352 ++PVT +TE LG++T +G R+ + ++ D+A Sbjct: 295 -------QVPVTTDVTERLGSDTFCHVNVDSGESLTVRVQGDCEVPYAARRYLTLDVAHC 347 Query: 353 HLFDGETGRALA 364 HLFD E+G +++ Sbjct: 348 HLFD-ESGLSVS 358 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 365 Length adjustment: 30 Effective length of query: 335 Effective length of database: 335 Effective search space: 112225 Effective search space used: 112225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory